Rabbit anti-Human, Mouse IL21 Polyclonal Antibody | anti-IL21 antibody

IL21 (Interleukin-21, IL-21, Za11, Interleukin21) (PE)

Cat. Num. AAA6382727

• Gene Names: IL21; Za11; IL-21
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL21; Polyclonal Antibody; IL21 (Interleukin-21; IL-21; Za11; Interleukin21) (PE); anti-IL21 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IL21. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-IL21 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human IL21, aa1-162 (NP_068575.1).
• Immunogen Sequence: MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in human liver.)

Western Blot (WB)

(IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in mouse kidney.)

Western Blot (WB)

(IL21 rabbit polyclonal antibody. Western Blot analysis of IL21 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of IL21 expression in transfected 293T cell line by IL21 polyclonal antibody. Lane 1: IL21 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL21 and DGKA. HeLa cells were stained with IL21 rabbit purified polyclonal 1:1200 and DGKA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Related Product Information for anti-IL21 antibody

Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B-and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.

Product Categories/Family for anti-IL21 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 11141875
• NCBI GeneID: 59067
• NCBI Accession #: NP_068575.1
• NCBI GenBank Nucleotide #: NM_021803
• UniProt Accession #: Q9HBE4; A5J0L4
• Molecular Weight: 17,923 Da
• NCBI Official Full Name: interleukin-21 isoform 1
• NCBI Official Synonym Full Names: interleukin 21
• NCBI Official Symbol: IL21
• NCBI Official Synonym Symbols: Za11; IL-21
• NCBI Protein Information: interleukin-21; OTTHUMP00000164088; interleukin-21 isoform
• UniProt Protein Name: Interleukin-21
• Protein Family: Interleukin
• UniProt Gene Name: IL21
• UniProt Synonym Gene Names: IL-21
• UniProt Entry Name: IL21_HUMAN

NCBI Description

This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

IL21: Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. Belongs to the IL-15/IL-21 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Secreted, signal peptide; Secreted; Cytokine; Cell development/differentiation

Chromosomal Location of Human Ortholog: 4q26-q27

Cellular Component: extracellular space

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor binding; interleukin-2 receptor binding; cytokine activity

Biological Process: positive regulation of interleukin-17 production; positive regulation of natural killer cell cytokine production; cell maturation; signal transduction; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of interleukin-10 production; positive regulation of tyrosine phosphorylation of Stat3 protein; positive regulation of natural killer cell differentiation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of tissue remodeling; positive regulation of cell proliferation; positive regulation of B cell proliferation; positive regulation of T cell proliferation; immune response; positive regulation of interferon-gamma biosynthetic process; positive regulation of inflammatory response

Disease: Immunodeficiency, Common Variable, 11