Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IL1RN expression in transfected 293T cell line by IL1RN polyclonal antibody. Lane 1: IL1RN transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human IL1RN Polyclonal Antibody | anti-IL1RN antibody

IL1RN (Interleukin-1 Receptor Antagonist Protein, IL-1ra, IL-1RN, IRAP, IL1 Inhibitor, ICIL-1RA, Anakinra, IL1RA, IL1F3, MGC10430) (Biotin)

Gene Names
IL1RN; DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL1RN; Polyclonal Antibody; IL1RN (Interleukin-1 Receptor Antagonist Protein; IL-1ra; IL-1RN; IRAP; IL1 Inhibitor; ICIL-1RA; Anakinra; IL1RA; IL1F3; MGC10430) (Biotin); anti-IL1RN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL1RN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-IL1RN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL1RN, aa1-177 (NP_776214.1).
Immunogen Sequence
MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IL1RN expression in transfected 293T cell line by IL1RN polyclonal antibody. Lane 1: IL1RN transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL1RN expression in transfected 293T cell line by IL1RN polyclonal antibody. Lane 1: IL1RN transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IL1RN antibody
The protein is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. A polymorphism of its gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer.
Product Categories/Family for anti-IL1RN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,055 Da
NCBI Official Full Name
interleukin-1 receptor antagonist protein isoform 1
NCBI Official Synonym Full Names
interleukin 1 receptor antagonist
NCBI Official Symbol
IL1RN
NCBI Official Synonym Symbols
DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
NCBI Protein Information
interleukin-1 receptor antagonist protein; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra)
UniProt Protein Name
Interleukin-1 receptor antagonist protein
UniProt Gene Name
IL1RN
UniProt Synonym Gene Names
IL1F3; IL1RA; IL-1RN; IL-1ra; IRAP
UniProt Entry Name
IL1RA_HUMAN

Uniprot Description

IL1RN: Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure. The intracellular form of IL1RN is predominantly expressed in epithelial cells. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Secreted; Secreted, signal peptide; Vesicle

Chromosomal Location of Human Ortholog: 2q14.2

Cellular Component: extracellular space; cytoplasm; plasma membrane; intracellular

Molecular Function: interleukin-1 Type I receptor antagonist activity; interleukin-1 receptor binding; interleukin-1 Type II receptor antagonist activity; interleukin-1, Type II receptor binding; cytokine activity; interleukin-1, Type I receptor binding; interleukin-1 receptor antagonist activity

Biological Process: response to drug; positive regulation of JNK activity; negative regulation of glutamate secretion; negative regulation of heterotypic cell-cell adhesion; response to glucocorticoid stimulus; carboxylic acid metabolic process; response to lipopolysaccharide; female pregnancy; sensory perception of pain; fever; chronic inflammatory response to antigenic stimulus; memory; response to starvation; insulin secretion; acute-phase response; negative regulation of cytokine and chemokine mediated signaling pathway; immune response; response to activity; lipid metabolic process; negative regulation of membrane potential; negative regulation of cell migration; negative regulation of apoptosis

Disease: Microvascular Complications Of Diabetes, Susceptibility To, 4; Gastric Cancer, Hereditary Diffuse; Osteomyelitis, Sterile Multifocal, With Periostitis And Pustulosis

Similar Products

Product Notes

The IL1RN il1rn (Catalog #AAA6382708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL1RN (Interleukin-1 Receptor Antagonist Protein, IL-1ra, IL-1RN, IRAP, IL1 Inhibitor, ICIL-1RA, Anakinra, IL1RA, IL1F3, MGC10430) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1RN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1RN il1rn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1RN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.