Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit GSTO1 Polyclonal Antibody | anti-GSTO1 antibody

GSTO1 (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (MaxLight 490)

Gene Names
GSTO1; P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTO1; Polyclonal Antibody; GSTO1 (Glutathione S-transferase omega-1; GSTO 1-1; GSTTLP28) (MaxLight 490); anti-GSTO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GSTO1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
793
Applicable Applications for anti-GSTO1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GSTO1, aa1-241 (NP_004823.1).
Immunogen Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Conjugate
MaxLight490
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GSTO1 antibody
GSTO1 is a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, this protein acts as a small stress response protein, likely involved in cellular redox homeostasis.
Product Categories/Family for anti-GSTO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens glutathione S-transferase omega 1 (GSTO1), mRNA
NCBI Official Synonym Full Names
glutathione S-transferase omega 1
NCBI Official Symbol
GSTO1
NCBI Official Synonym Symbols
P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21
NCBI Protein Information
glutathione S-transferase omega-1
Protein Family

NCBI Description

The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]

Research Articles on GSTO1

Similar Products

Product Notes

The GSTO1 (Catalog #AAA6380435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTO1 (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (MaxLight 490) reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GSTO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTO1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.