Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human GCNT2 Polyclonal Antibody | anti-GCNT2 antibody

GCNT2 (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, Isoform A, N-acetylglucosaminyltransferase, I-branching Enzyme, IGNT, GCNT5, II, NACGT1) (MaxLight 650)

Gene Names
GCNT2; II; CCAT; IGNT; ULG3; GCNT5; GCNT2C; NACGT1; NAGCT1; CTRCT13; bA421M1.1; bA360O19.2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GCNT2; Polyclonal Antibody; GCNT2 (N-acetyllactosaminide beta-1; 6-N-acetylglucosaminyl-transferase; Isoform A; N-acetylglucosaminyltransferase; I-branching Enzyme; IGNT; GCNT5; II; NACGT1) (MaxLight 650); anti-GCNT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GCNT2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
402
Applicable Applications for anti-GCNT2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GCNT2, aa1-402 (NP_663630.2).
Immunogen Sequence
MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GCNT2 antibody
GCNT2 is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase that converts linear into branched poly-N-acetyllactosaminoglycans and is responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding 3 different isoforms have been described.
Product Categories/Family for anti-GCNT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform C
NCBI Official Synonym Full Names
glucosaminyl (N-acetyl) transferase 2 (I blood group)
NCBI Official Symbol
GCNT2
NCBI Official Synonym Symbols
II; CCAT; IGNT; ULG3; GCNT5; GCNT2C; NACGT1; NAGCT1; CTRCT13; bA421M1.1; bA360O19.2
NCBI Protein Information
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
UniProt Protein Name
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform A
UniProt Gene Name
GCNT2
UniProt Synonym Gene Names
GCNT5; II; NACGT1; N-acetylglucosaminyltransferase
UniProt Entry Name
GNT2A_HUMAN

NCBI Description

This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

GCNT2A: Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells. The expression of the blood group I antigen in erythrocytes is determined by isoform C. Belongs to the glycosyltransferase 14 family. 3 isoforms of the human protein are produced by alternative splicing

Protein type: EC 2.4.1.150

Chromosomal Location of Human Ortholog: 6p24.2

Cellular Component: Golgi membrane; membrane; integral to membrane

Molecular Function: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity

Biological Process: glycosaminoglycan biosynthetic process; positive regulation of protein kinase B signaling cascade; positive regulation of heterotypic cell-cell adhesion; multicellular organismal development; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; protein amino acid glycosylation; positive regulation of cell migration

Disease: Blood Group, I System

Research Articles on GCNT2

Similar Products

Product Notes

The GCNT2 gcnt2 (Catalog #AAA6379634) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCNT2 (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, Isoform A, N-acetylglucosaminyltransferase, I-branching Enzyme, IGNT, GCNT5, II, NACGT1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCNT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GCNT2 gcnt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GCNT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.