Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human FCN3 Polyclonal Antibody | anti-FCN3 antibody

FCN3 (FCNH, HAKA1, Ficolin-3, Collagen/Fibrinogen Domain-containing Lectin 3 p35, Collagen/Fibrinogen Domain-containing Protein 3, Hakata Antigen, MGC22543) (Biotin)

Gene Names
FCN3; FCNH; HAKA1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FCN3; Polyclonal Antibody; FCN3 (FCNH; HAKA1; Ficolin-3; Collagen/Fibrinogen Domain-containing Lectin 3 p35; Collagen/Fibrinogen Domain-containing Protein 3; Hakata Antigen; MGC22543) (Biotin); anti-FCN3 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FCN3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FCN3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FCN3, aa1-288 (AAH20731.1).
Immunogen Sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FCN3 expression in transfected 293T cell line by FCN3 polyclonal antibody. Lane 1: FCN3 transfected lysate (31.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FCN3 antibody
Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified.
Product Categories/Family for anti-FCN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,678 Da
NCBI Official Full Name
Ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
NCBI Official Synonym Full Names
ficolin (collagen/fibrinogen domain containing) 3
NCBI Official Symbol
FCN3
NCBI Official Synonym Symbols
FCNH; HAKA1
NCBI Protein Information
ficolin-3; H-ficolin; ficolin 3; collagen/fibrinogen domain-containing protein 3; collagen/fibrinogen domain-containing lectin 3 p35; ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Protein Family

NCBI Description

Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified. [provided by RefSeq, Jul 2008]

Research Articles on FCN3

Similar Products

Product Notes

The FCN3 (Catalog #AAA6378363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCN3 (FCNH, HAKA1, Ficolin-3, Collagen/Fibrinogen Domain-containing Lectin 3 p35, Collagen/Fibrinogen Domain-containing Protein 3, Hakata Antigen, MGC22543) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FCN3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FCN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual