Rabbit anti-Human FBXL8 Polyclonal Antibody | anti-FBXL8 antibody

FBXL8 (FBL8, F-box/LRR-repeat Protein 8, F-box and Leucine-rich Repeat Protein 8, F-box Protein FBL8, FLJ11278, MGC19959) (Biotin)

Cat. Num. AAA6378231

• Gene Names: FBXL8; FBL8
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FBXL8; Polyclonal Antibody; FBXL8 (FBL8; F-box/LRR-repeat Protein 8; F-box and Leucine-rich Repeat Protein 8; F-box Protein FBL8; FLJ11278; MGC19959) (Biotin); anti-FBXL8 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FBXL8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-FBXL8 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human FBXL8, aa1-374 (NP_060848.2).
• Immunogen Sequence: MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FBXL8 expression in transfected 293T cell line by FBXL8 polyclonal antibody. Lane 1: FBXL8 transfected lysate (40.5kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-FBXL8 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 22547146
• NCBI GeneID: 55336
• NCBI Accession #: NP_060848.2
• NCBI GenBank Nucleotide #: NM_018378.2
• Molecular Weight: 40,516 Da
• NCBI Official Full Name: F-box/LRR-repeat protein 8
• NCBI Official Synonym Full Names: F-box and leucine rich repeat protein 8
• NCBI Official Symbol: FBXL8
• NCBI Official Synonym Symbols: FBL8
• NCBI Protein Information: F-box/LRR-repeat protein 8
• Protein Family: F-box/LRR-repeat protein

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. It shares 78% sequence identity with the mouse protein. [provided by RefSeq, Jul 2008]