Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human FABP7 Polyclonal Antibody | anti-FABP7 antibody

FABP7 (Fatty Acid-binding Protein, Brain, Brain Lipid-binding Protein, BLBP, Brain-type Fatty Acid-binding Protein, B-FABP, Fatty Acid-binding Protein 7, Mammary-derived Growth Inhibitor Related, BLBP, FABPB, MRG) (MaxLight 405)

Gene Names
FABP7; MRG; BLBP; FABPB; B-FABP; LTR2-FABP7
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FABP7; Polyclonal Antibody; FABP7 (Fatty Acid-binding Protein; Brain; Brain Lipid-binding Protein; BLBP; Brain-type Fatty Acid-binding Protein; B-FABP; Fatty Acid-binding Protein 7; Mammary-derived Growth Inhibitor Related; FABPB; MRG) (MaxLight 405); anti-FABP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FABP7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-FABP7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FABP7, aa1-132 (NP_001437.1).
Immunogen Sequence
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FABP7 antibody
FABP7 (Fatty acid binding protein 7) is also known as brain fatty acid-binding protein (B-FABP) and is a member of fatty acid-binding proteins (FABPs) which are a family of small, highly conserved, cytoplasmic proteins to bind long-chain fatty acids and other hydrophobic ligands. FABP7 is expressed in radial glia by the activation of Notch receptors and binds DHA with the highest affinity among all of FABPs.
Product Categories/Family for anti-FABP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,829 Da
NCBI Official Full Name
fatty acid-binding protein, brain
NCBI Official Synonym Full Names
fatty acid binding protein 7, brain
NCBI Official Symbol
FABP7
NCBI Official Synonym Symbols
MRG; BLBP; FABPB; B-FABP; LTR2-FABP7
NCBI Protein Information
fatty acid-binding protein, brain; Hypothetical protein DKFZp547J2313; brain lipid binding protein; brain lipid-binding protein; brain-type fatty acid-binding protein; fatty acid-binding protein 7; mammary-derived growth inhibitor related; mammary-derived
UniProt Protein Name
Fatty acid-binding protein, brain
UniProt Gene Name
FABP7
UniProt Synonym Gene Names
BLBP; FABPB; MRG; BLBP; B-FABP
UniProt Entry Name
FABP7_HUMAN

NCBI Description

The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]

Uniprot Description

FABP7: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Cell development/differentiation; Lipid-binding; Cell cycle regulation

Chromosomal Location of Human Ortholog: 6q22-q23

Cellular Component: cell projection; cell soma; cytoplasm; nucleus

Molecular Function: transporter activity; lipid binding

Biological Process: negative regulation of cell proliferation; nervous system development; epithelial cell proliferation; prepulse inhibition; neurogenesis; transport; cell proliferation in forebrain

Research Articles on FABP7

Similar Products

Product Notes

The FABP7 fabp7 (Catalog #AAA6377926) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FABP7 (Fatty Acid-binding Protein, Brain, Brain Lipid-binding Protein, BLBP, Brain-type Fatty Acid-binding Protein, B-FABP, Fatty Acid-binding Protein 7, Mammary-derived Growth Inhibitor Related, BLBP, FABPB, MRG) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FABP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FABP7 fabp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FABP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.