Western Blot (WB)
(ESM1 rabbit polyclonal antibody. Western Blot analysis of ESM1 expression in human kidney.)
Rabbit anti-Human ESM1 Polyclonal Antibody | anti-ESM1 antibody
ESM1 (Endothelial Cell-specific Molecule 1, ESM-1) (HRP)
Gene Names
ESM1; endocan
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ESM1; Polyclonal Antibody; ESM1 (Endothelial Cell-specific Molecule 1; ESM-1) (HRP); anti-ESM1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ESM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-ESM1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ESM1, aa1-184 (NP_008967.1).
Immunogen Sequence
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(ESM1 rabbit polyclonal antibody. Western Blot analysis of ESM1 expression in human kidney.)
Western Blot (WB)
(ESM1 rabbit polyclonal antibody. Western Blot analysis of ESM1 expression in human kidney.)
Western Blot (WB)
(Western Blot analysis of ESM1 expression in transfected 293T cell line by ESM1 polyclonal antibody. Lane 1: ESM1 transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ESM1 expression in transfected 293T cell line by ESM1 polyclonal antibody. Lane 1: ESM1 transfected lysate (20.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ESM1 antibody
May have potent implications in lung endothelial cell-leukocyte interactions.
Product Categories/Family for anti-ESM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,095 Da
NCBI Official Full Name
endothelial cell-specific molecule 1 isoform a
NCBI Official Synonym Full Names
endothelial cell-specific molecule 1
NCBI Official Symbol
ESM1
NCBI Official Synonym Symbols
endocan
NCBI Protein Information
endothelial cell-specific molecule 1; ESM-1
UniProt Protein Name
Endothelial cell-specific molecule 1
Protein Family
UniProt Gene Name
ESM1
UniProt Synonym Gene Names
ESM-1
UniProt Entry Name
ESM1_HUMAN
Uniprot Description
ESM1: May have potent implications in lung endothelial cell- leukocyte interactions. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 5q11.2
Cellular Component: extracellular region
Molecular Function: integrin binding; insulin-like growth factor binding; hepatocyte growth factor receptor binding
Biological Process: positive regulation of cell proliferation; regulation of cell growth; angiogenesis; sprouting angiogenesis
Similar Products
Product Notes
The ESM1 esm1 (Catalog #AAA6377694) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESM1 (Endothelial Cell-specific Molecule 1, ESM-1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ESM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ESM1 esm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ESM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
