Western Blot (WB)
(CREM rabbit polyclonal antibody. Western Blot analysis of CREM expression in HeLa.)
Rabbit anti-Human CREM Polyclonal Antibody | anti-CREM antibody
CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (Biotin)
Gene Names
CREM; ICER; CREM-2; hCREM-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREM; Polyclonal Antibody; CREM (cAMP-responsive Element Modulator; Inducible cAMP Early Repressor; ICER) (Biotin); anti-CREM antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CREM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CREM antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CREM, aa1-137 (NP_001872.3).
Immunogen Sequence
MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CREM rabbit polyclonal antibody. Western Blot analysis of CREM expression in HeLa.)
Western Blot (WB)
(CREM rabbit polyclonal antibody. Western Blot analysis of CREM expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of CREM expression in transfected 293T cell line by CREM polyclonal antibody. Lane 1: CREM transfected lysate (14.9kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CREM expression in transfected 293T cell line by CREM polyclonal antibody. Lane 1: CREM transfected lysate (14.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CREM antibody
Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in spermatid maturation.
Product Categories/Family for anti-CREM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,269 Da
NCBI Official Full Name
Homo sapiens cAMP responsive element modulator (CREM), transcript variant 2, mRNA
NCBI Official Synonym Full Names
cAMP responsive element modulator
NCBI Official Symbol
CREM
NCBI Official Synonym Symbols
ICER; CREM-2; hCREM-2
NCBI Protein Information
cAMP-responsive element modulator; CREM 2alpha-b protein; CREM 2beta-a protein; cAMP response element modulator; inducible cAMP early repressor ICER
Protein Family
NCBI Description
This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq, Jul 2008]
Research Articles on CREM
Similar Products
Product Notes
The CREM (Catalog #AAA6374711) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CREM (cAMP-responsive Element Modulator, Inducible cAMP Early Repressor, ICER) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CREM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREM for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
