Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of COX4I1 expression in transfected 293T cell line by COX4I1 polyclonal antibody. Lane 1: COX4I1 transfected lysate (19.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human COX4I1 Polyclonal Antibody | anti-COX4I1 antibody

COX4I1 (Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial, Cytochrome C Oxidase Polypeptide IV, Cytochrome C Oxidase Subunit IV Isoform 1, COX IV-1, COX4) (Biotin)

Gene Names
COX4I1; COX4; COXIV; COX4-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COX4I1; Polyclonal Antibody; COX4I1 (Cytochrome C Oxidase Subunit 4 Isoform 1; Mitochondrial; Cytochrome C Oxidase Polypeptide IV; Cytochrome C Oxidase Subunit IV Isoform 1; COX IV-1; COX4) (Biotin); anti-COX4I1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human COX4I1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-COX4I1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human COX4I1, aa1-169 (NP_001852.1).
Immunogen Sequence
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of COX4I1 expression in transfected 293T cell line by COX4I1 polyclonal antibody. Lane 1: COX4I1 transfected lysate (19.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of COX4I1 expression in transfected 293T cell line by COX4I1 polyclonal antibody. Lane 1: COX4I1 transfected lysate (19.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-COX4I1 antibody
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Product Categories/Family for anti-COX4I1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,577 Da
NCBI Official Full Name
cytochrome c oxidase subunit 4 isoform 1, mitochondrial
NCBI Official Synonym Full Names
cytochrome c oxidase subunit IV isoform 1
NCBI Official Symbol
COX4I1
NCBI Official Synonym Symbols
COX4; COXIV; COX4-1
NCBI Protein Information
cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX IV-1; cytochrome c oxidase polypeptide IV
UniProt Protein Name
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Protein Family
UniProt Gene Name
COX4I1
UniProt Synonym Gene Names
COX4; COX IV-1
UniProt Entry Name
COX41_HUMAN

NCBI Description

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. [provided by RefSeq, Jul 2008]

Uniprot Description

COX4I1: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Ubiquitous. Belongs to the cytochrome c oxidase IV family.

Protein type: Oxidoreductase; Mitochondrial; EC 1.9.3.1; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: membrane; mitochondrion; mitochondrial inner membrane; nucleus

Molecular Function: protein binding; cytochrome-c oxidase activity

Biological Process: cellular metabolic process; generation of precursor metabolites and energy; transmembrane transport; response to nutrient

Research Articles on COX4I1

Similar Products

Product Notes

The COX4I1 cox4i1 (Catalog #AAA6374491) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COX4I1 (Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial, Cytochrome C Oxidase Polypeptide IV, Cytochrome C Oxidase Subunit IV Isoform 1, COX IV-1, COX4) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COX4I1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COX4I1 cox4i1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COX4I1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.