Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CHIA rabbit polyclonal antibody. Western Blot analysis of CHIA expression in mouse intestine.)

Rabbit anti-Human, Mouse CHIA Polyclonal Antibody | anti-CHIA antibody

CHIA (Acidic Mammalian Chitinase, AMCase, Lung-specific Protein TSA1902) (Biotin)

Gene Names
CHIA; CHIT2; AMCASE; TSA1902
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHIA; Polyclonal Antibody; CHIA (Acidic Mammalian Chitinase; AMCase; Lung-specific Protein TSA1902) (Biotin); anti-CHIA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CHIA. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
368
Applicable Applications for anti-CHIA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CHIA, aa1-368 (NP_068569.2).
Immunogen Sequence
MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CHIA rabbit polyclonal antibody. Western Blot analysis of CHIA expression in mouse intestine.)

Western Blot (WB) (CHIA rabbit polyclonal antibody. Western Blot analysis of CHIA expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of CHIA expression in transfected 293T cell line by CHIA polyclonal antibody. Lane 1: CHIA transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CHIA expression in transfected 293T cell line by CHIA polyclonal antibody. Lane 1: CHIA transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CHIA antibody
CHIA degrades chitin and chitotriose. May participate in the defense against nematodes and other pathogens. There are 3 named isoforms produced by alternative splicing. CHIA is induced via a T helper-2 (Th2)-specific, interleukin-13-mediated pathway in epithelial cells and macrophages. CHIA may be an important mediator of IL13-induced responses in Th2-dominated disorders such as asthma. CHIA hydrolysis N-acetyl-beta-D-glucosaminide 1,4-beta-linkages in chitin and chitodextrins.
Product Categories/Family for anti-CHIA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
acidic mammalian chitinase isoform a
NCBI Official Synonym Full Names
chitinase acidic
NCBI Official Symbol
CHIA
NCBI Official Synonym Symbols
CHIT2; AMCASE; TSA1902
NCBI Protein Information
acidic mammalian chitinase
UniProt Protein Name
Acidic mammalian chitinase
Protein Family
UniProt Gene Name
CHIA
UniProt Synonym Gene Names
AMCase
UniProt Entry Name
CHIA_HUMAN

NCBI Description

The protein encoded by this gene degrades chitin, which is found in the cell wall of most fungi as well as in arthropods and some nematodes. The encoded protein can also stimulate interleukin 13 expression, and variations in this gene can lead to asthma susceptibility. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

CHIA: Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding. Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Secreted, signal peptide; Secreted; EC 3.2.1.14

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: lysozyme activity; chitin binding; chitinase activity; carbohydrate binding; kinase binding

Biological Process: response to fungus; polysaccharide catabolic process; apoptosis; production of molecular mediator of acute inflammatory response; cell wall chitin metabolic process; digestion; immune response; chitin catabolic process; chitin metabolic process

Research Articles on CHIA

Similar Products

Product Notes

The CHIA chia (Catalog #AAA6373853) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHIA (Acidic Mammalian Chitinase, AMCase, Lung-specific Protein TSA1902) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CHIA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHIA chia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHIA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.