Western Blot (WB)
(ELA3A rabbit polyclonal antibody. Western Blot analysis of ELA3A expression in human pancreas)
Rabbit anti-Human CELA3A Polyclonal Antibody | anti-CELA3A antibody
CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, Protease E) APC
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CELA3A; Polyclonal Antibody; CELA3A (ELA3; ELA3A; Chymotrypsin-like Elastase Family Member 3A; Elastase IIIA; Elastase-3A; Protease E) APC; anti-CELA3A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ELA3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
270
Applicable Applications for anti-CELA3A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human ELA3A, aa1-270 (NP_005738.3).
Immunogen Sequence
MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(ELA3A rabbit polyclonal antibody. Western Blot analysis of ELA3A expression in human pancreas)
Western Blot (WB)
(ELA3A rabbit polyclonal antibody. Western Blot analysis of ELA3A expression in human pancreas)
Western Blot (WB)
(Western Blot analysis of ELA3A expression in transfected 293T cell line by ELA3A polyclonal antibody. Lane 1: ELA3A transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ELA3A expression in transfected 293T cell line by ELA3A polyclonal antibody. Lane 1: ELA3A transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CELA3A antibody
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1.
Product Categories/Family for anti-CELA3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
elastase 3A, pancreatic preproprotein
Protein Family
Similar Products
Product Notes
The CELA3A (Catalog #AAA6373632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, Protease E) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CELA3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CELA3A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CELA3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
