Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CCL21 expression in transfected 293T cell line by CCL21 polyclonal antibody. Lane 1: CCL21 transfected lysate (14.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CCL21 Polyclonal Antibody | anti-CCL21 antibody

CCL21 (SCYA21, C-C Motif Chemokine 21, 6Ckine, Beta-chemokine Exodus-2, Secondary Lymphoid-tissue Chemokine, Small-inducible Cytokine A21, MGC34555) (FITC)

Gene Names
CCL21; ECL; SLC; CKb9; TCA4; 6Ckine; SCYA21
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL21; Polyclonal Antibody; CCL21 (SCYA21; C-C Motif Chemokine 21; 6Ckine; Beta-chemokine Exodus-2; Secondary Lymphoid-tissue Chemokine; Small-inducible Cytokine A21; MGC34555) (FITC); anti-CCL21 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCL21.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-CCL21 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCL21, aa1-134 (NP_002980.1).
Immunogen Sequence
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCL21 expression in transfected 293T cell line by CCL21 polyclonal antibody. Lane 1: CCL21 transfected lysate (14.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCL21 expression in transfected 293T cell line by CCL21 polyclonal antibody. Lane 1: CCL21 transfected lysate (14.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CCL21 antibody
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq].
Product Categories/Family for anti-CCL21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,646 Da
NCBI Official Full Name
C-C motif chemokine 21
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 21
NCBI Official Symbol
CCL21
NCBI Official Synonym Symbols
ECL; SLC; CKb9; TCA4; 6Ckine; SCYA21
NCBI Protein Information
C-C motif chemokine 21; Efficient Chemoattractant for Lymphocytes; beta chemokine exodus-2; secondary lymphoid tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21
UniProt Protein Name
C-C motif chemokine 21
Protein Family
UniProt Gene Name
CCL21
UniProt Synonym Gene Names
SCYA21; SLC
UniProt Entry Name
CCL21_HUMAN

NCBI Description

This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq, Sep 2014]

Research Articles on CCL21

Similar Products

Product Notes

The CCL21 ccl21 (Catalog #AAA6372567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCL21 (SCYA21, C-C Motif Chemokine 21, 6Ckine, Beta-chemokine Exodus-2, Secondary Lymphoid-tissue Chemokine, Small-inducible Cytokine A21, MGC34555) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL21 ccl21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.