Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CBX5 rabbit polyclonal antibody. Western Blot analysis of CBX5 expression in Jurkat.)

Rabbit anti-Human CBX5 Polyclonal Antibody | anti-CBX5 antibody

CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (AP)

Gene Names
CBX5; HP1; HP1A; HEL25
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CBX5; Polyclonal Antibody; CBX5 (Chromobox Protein Homolog 5; Antigen p25; Heterochromatin Protein 1 Homolog alpha; HP1 alpha; HP1A) (AP); anti-CBX5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CBX5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CBX5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CBX5, aa1-191 (NP_036249.1).
Immunogen Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CBX5 rabbit polyclonal antibody. Western Blot analysis of CBX5 expression in Jurkat.)

Western Blot (WB) (CBX5 rabbit polyclonal antibody. Western Blot analysis of CBX5 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of CBX5 expression in transfected 293T cell line by CBX5 polyclonal antibody. Lane 1: CBX5 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CBX5 expression in transfected 293T cell line by CBX5 polyclonal antibody. Lane 1: CBX5 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified rabbit antibody to CBX5 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified rabbit antibody to CBX5 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-CBX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,225 Da
NCBI Official Full Name
chromobox protein homolog 5
NCBI Official Synonym Full Names
chromobox homolog 5
NCBI Official Symbol
CBX5
NCBI Official Synonym Symbols
HP1; HP1A; HEL25
NCBI Protein Information
chromobox protein homolog 5; HP1-ALPHA; HP1Hs alpha; antigen p25; HP1 alpha homolog; epididymis luminal protein 25; heterochromatin protein 1-alpha; heterochromatin protein 1 homolog alpha; chromobox homolog 5 (HP1 alpha homolog, Drosophila)
UniProt Protein Name
Chromobox protein homolog 5
Protein Family
UniProt Gene Name
CBX5
UniProt Synonym Gene Names
HP1A; HP1 alpha
UniProt Entry Name
CBX5_HUMAN

NCBI Description

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

HP1 alpha: Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. Interacts with SUV420H1 and SUV420H2. Interacts with HP1BP3. Interacts directly with ATRX, CHAF1A, LBR, NIPBL, SP100, STAM2 and TRIM28 via the chromoshadow domain. Can interact directly with CBX3 via the chromoshadow domain. Interacts with histone H3 methylated at 'Lys- 9'. Interacts with BAHD1, MIS12 and DSN1. Interacts with POGZ; POGZ and PXVXL motif-containing proteins such as INCENP and TRIM28 compete for interaction with CBX5. Interacts with INCENP and TRIM24. Interacts with JC virus agnoprotein; this interaction induces the dissociation of CBX5 from LBR, resulting in destabilization of the nuclear envelope. Interacts with CHAMP1. Interacts with ASXL1.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: kinetochore; nucleoplasm; PML body; histone methyltransferase complex; transcriptional repressor complex; histone deacetylase complex; nucleolus; nuclear envelope; nuclear heterochromatin; nucleus; chromocenter

Molecular Function: protein binding, bridging; protein binding; protein homodimerization activity; histone deacetylase binding; chromatin binding; methylated histone residue binding

Biological Process: viral reproduction; negative regulation of transcription, DNA-dependent; blood coagulation

Research Articles on CBX5

Similar Products

Product Notes

The CBX5 cbx5 (Catalog #AAA6372432) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBX5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CBX5 cbx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CBX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.