Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CA3 rabbit polyclonal antibody. Western Blot analysis of CA3 expression in human liver.)

Rabbit anti-Human, Mouse CA3 Polyclonal Antibody | anti-CA3 antibody

CA3 (Carbonic Anhydrase 3, Carbonic Anhydrase III, CA-III, Carbonate Dehydratase III) (AP)

Gene Names
CA3; Car3; CAIII
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CA3; Polyclonal Antibody; CA3 (Carbonic Anhydrase 3; Carbonic Anhydrase III; CA-III; Carbonate Dehydratase III) (AP); anti-CA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CA3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CA3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CA3, aa1-260 (NP_005172.1).
Immunogen Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CA3 rabbit polyclonal antibody. Western Blot analysis of CA3 expression in human liver.)

Western Blot (WB) (CA3 rabbit polyclonal antibody. Western Blot analysis of CA3 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of CA3 expression in transfected 293T cell line by CA3 polyclonal antibody. Lane 1: CA3 transfected lysate (29.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CA3 expression in transfected 293T cell line by CA3 polyclonal antibody. Lane 1: CA3 transfected lysate (29.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CA3 antibody
Carbonic anhydrase III (CAIII) is a member of carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal.
Product Categories/Family for anti-CA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
761
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,557 Da
NCBI Official Full Name
carbonic anhydrase 3
NCBI Official Synonym Full Names
carbonic anhydrase III, muscle specific
NCBI Official Symbol
CA3
NCBI Official Synonym Symbols
Car3; CAIII
NCBI Protein Information
carbonic anhydrase 3; CA-III; carbonate dehydratase III
UniProt Protein Name
Carbonic anhydrase 3
Protein Family
UniProt Gene Name
CA3
UniProt Synonym Gene Names
CA-III
UniProt Entry Name
CAH3_HUMAN

NCBI Description

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns. [provided by RefSeq, Oct 2008]

Uniprot Description

CA3: Reversible hydration of carbon dioxide. Belongs to the alpha-carbonic anhydrase family.

Protein type: EC 4.2.1.1; Lyase; Energy Metabolism - nitrogen

Chromosomal Location of Human Ortholog: 8q21.2

Cellular Component: cytosol

Molecular Function: carbonate dehydratase activity; zinc ion binding; nickel ion binding

Biological Process: response to ethanol; bicarbonate transport; one-carbon compound metabolic process; response to oxidative stress

Research Articles on CA3

Similar Products

Product Notes

The CA3 ca3 (Catalog #AAA6371805) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA3 (Carbonic Anhydrase 3, Carbonic Anhydrase III, CA-III, Carbonate Dehydratase III) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CA3 ca3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.