Rabbit anti-Human C1QC Polyclonal Antibody | anti-C1QC antibody

C1QC (Complement C1q Subcomponent Subunit C, C1QG) (FITC)

Cat. Num. AAA6371610

• Gene Names: C1QC; C1QG; C1Q-C
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: C1QC; Polyclonal Antibody; C1QC (Complement C1q Subcomponent Subunit C; C1QG) (FITC); anti-C1QC antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human C1QC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-C1QC antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human C1QC, aa1-245 (NP_758957.2).
• Immunogen Sequence: MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(C1QC rabbit polyclonal antibody. Western Blot analysis of C1QC expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of C1QC expression in transfected 293T cell line by C1QC polyclonal antibody. Lane 1: C1QC transfected lysate (25.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-C1QC antibody

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Product Categories/Family for anti-C1QC antibody

Antibodies; Complement

NCBI and Uniprot Product Information

• NCBI GI #: 56786155
• NCBI GeneID: 714
• NCBI Accession #: NP_758957.2
• NCBI GenBank Nucleotide #: NM_172369
• Molecular Weight: 25,774 Da
• NCBI Official Full Name: complement C1q subcomponent subunit C
• NCBI Official Synonym Full Names: complement component 1, q subcomponent, C chain
• NCBI Official Symbol: C1QC
• NCBI Official Synonym Symbols: C1QG; C1Q-C
• NCBI Protein Information: complement C1q subcomponent subunit C; complement component 1, q subcomponent, gamma polypeptide
• Protein Family: Complement C1q subcomponent

NCBI Description

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]