Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C1QB rabbit polyclonal antibody. Western Blot analysis of C1QB expression in human kidney.)

Rabbit anti-Human, Mouse C1QB Polyclonal Antibody | anti-C1QB antibody

C1QB (Complement C1q Subcomponent Subunit B) APC

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C1QB; Polyclonal Antibody; C1QB (Complement C1q Subcomponent Subunit B) APC; anti-C1QB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C1QB. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-C1QB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human C1QB, aa1-253 (NP_000482.3).
Immunogen Sequence
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(C1QB rabbit polyclonal antibody. Western Blot analysis of C1QB expression in human kidney.)

Western Blot (WB) (C1QB rabbit polyclonal antibody. Western Blot analysis of C1QB expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of C1QB expression in transfected 293T cell line by C1QB polyclonal antibody. Lane 1: C1QB transfected lysate (26.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C1QB expression in transfected 293T cell line by C1QB polyclonal antibody. Lane 1: C1QB transfected lysate (26.7kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-C1QB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
713
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,722 Da
NCBI Official Full Name
complement C1q subcomponent subunit B
NCBI Official Synonym Full Names
complement component 1, q subcomponent, B chain
NCBI Official Symbol
C1QB
NCBI Protein Information
complement C1q subcomponent subunit B; complement component C1q, B chain; complement subcomponent C1q chain B; complement component 1, q subcomponent, beta polypeptide
UniProt Protein Name
Complement C1q subcomponent subunit B
UniProt Gene Name
C1QB
UniProt Entry Name
C1QB_HUMAN

NCBI Description

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q [provided by RefSeq, Jul 2008]

Uniprot Description

C1QB: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes. Defects in C1QB are a cause of complement component C1q deficiency (C1QD). A rare defect resulting in C1 deficiency and impaired activation of the complement classical pathway. C1 deficiency generally leads to severe immune complex disease with features of systemic lupus erythematosus and glomerulonephritis.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p36.12

Cellular Component: collagen; extracellular region; complement component C1 complex

Molecular Function: protein binding; protein homodimerization activity

Biological Process: innate immune response; inner ear development; complement activation, classical pathway; complement activation

Disease: C1q Deficiency

Research Articles on C1QB

Similar Products

Product Notes

The C1QB c1qb (Catalog #AAA6371597) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1QB (Complement C1q Subcomponent Subunit B) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's C1QB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C1QB c1qb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C1QB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.