Western Blot (WB)
(Western Blot analysis of BGN expression in transfected 293T cell line by 123922 Lane 1: BGN transfected lysate (41.7kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human BGN Polyclonal Antibody | anti-BGN antibody
BGN (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (Biotin)
Gene Names
BGN; PGI; DSPG1; PG-S1; SLRR1A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BGN; Polyclonal Antibody; BGN (Biglycan; Bone/Cartilage Proteoglycan I; PG-S1; SLRR1A) (Biotin); anti-BGN antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BGN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BGN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BGN, aa1-368 (NP_001702.1).
Immunogen Sequence
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of BGN expression in transfected 293T cell line by 123922 Lane 1: BGN transfected lysate (41.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of BGN expression in transfected 293T cell line by 123922 Lane 1: BGN transfected lysate (41.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BGN antibody
BGN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival.
Product Categories/Family for anti-BGN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42kDa
NCBI Official Full Name
biglycan preproprotein
NCBI Official Synonym Full Names
biglycan
NCBI Official Symbol
BGN
NCBI Official Synonym Symbols
PGI; DSPG1; PG-S1; SLRR1A
NCBI Protein Information
biglycan; biglycan proteoglycan; bone/cartilage proteoglycan I; bone/cartilage proteoglycan-I; small leucine-rich protein 1A; dermatan sulphate proteoglycan I
UniProt Protein Name
Biglycan
Protein Family
UniProt Gene Name
BGN
UniProt Synonym Gene Names
SLRR1A
UniProt Entry Name
PGS1_HUMAN
Similar Products
Product Notes
The BGN bgn (Catalog #AAA6371213) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BGN (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BGN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BGN bgn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BGN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
