Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ATIC expression in transfected 293T cell line by ATIC polyclonal antibody. Lane 1: ATIC transfected lysate (64.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ATIC Polyclonal Antibody | anti-ATIC antibody

ATIC (Bifunctional Purine Biosynthesis Protein PURH, Phosphoribosylaminoimidazolecarboxamide Formyltransferase, 5-aminoimidazole-4-carboxamide Ribonucleotide Formyltransferase, AICAR Transformylase, IMP Cyclohydrolase, ATIC, IMP Synthase, Inosinicase, PUR

Gene Names
ATIC; PURH; AICAR; AICARFT; IMPCHASE
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATIC; Polyclonal Antibody; ATIC (Bifunctional Purine Biosynthesis Protein PURH; Phosphoribosylaminoimidazolecarboxamide Formyltransferase; 5-aminoimidazole-4-carboxamide Ribonucleotide Formyltransferase; AICAR Transformylase; IMP Cyclohydrolase; IMP Synthase; Inosinicase; PUR; anti-ATIC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATIC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ATIC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ATIC, aa1-592 (NP_004035.2).
Immunogen Sequence
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATIC expression in transfected 293T cell line by ATIC polyclonal antibody. Lane 1: ATIC transfected lysate (64.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATIC expression in transfected 293T cell line by ATIC polyclonal antibody. Lane 1: ATIC transfected lysate (64.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ATIC antibody
ATIC is a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity.
Product Categories/Family for anti-ATIC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
471
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,616 Da
NCBI Official Full Name
bifunctional purine biosynthesis protein PURH
NCBI Official Synonym Full Names
5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
NCBI Official Symbol
ATIC
NCBI Official Synonym Symbols
PURH; AICAR; AICARFT; IMPCHASE
NCBI Protein Information
bifunctional purine biosynthesis protein PURH; AICARFT/IMPCHASE; AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme; phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucl
UniProt Protein Name
Bifunctional purine biosynthesis protein PURH
UniProt Gene Name
ATIC
UniProt Synonym Gene Names
PURH
UniProt Entry Name
PUR9_HUMAN

Similar Products

Product Notes

The ATIC atic (Catalog #AAA6370640) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATIC (Bifunctional Purine Biosynthesis Protein PURH, Phosphoribosylaminoimidazolecarboxamide Formyltransferase, 5-aminoimidazole-4-carboxamide Ribonucleotide Formyltransferase, AICAR Transformylase, IMP Cyclohydrolase, ATIC, IMP Synthase, Inosinicase, PUR reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATIC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATIC atic for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATIC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.