Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse ARHGDIB Polyclonal Antibody | anti-ARHGDIB antibody

ARHGDIB (Rho GDP-dissociation Inhibitor 2, Rho GDI 2, Ly-GDI, Rho-GDI beta, GDIA2, GDID4, RAP1GN1) (MaxLight 490)

Gene Names
ARHGDIB; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; RhoGDI2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARHGDIB; Polyclonal Antibody; ARHGDIB (Rho GDP-dissociation Inhibitor 2; Rho GDI 2; Ly-GDI; Rho-GDI beta; GDIA2; GDID4; RAP1GN1) (MaxLight 490); anti-ARHGDIB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ARHGDIB. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ARHGDIB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ARHGDIB, aa1-201 (NP_001166.3).
Immunogen Sequence
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Conjugate
MaxLight490
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ARHGDIB antibody
Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
Product Categories/Family for anti-ARHGDIB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
397
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,988 Da
NCBI Official Full Name
rho GDP-dissociation inhibitor 2
NCBI Official Synonym Full Names
Rho GDP dissociation inhibitor (GDI) beta
NCBI Official Symbol
ARHGDIB
NCBI Official Synonym Symbols
D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; RhoGDI2
NCBI Protein Information
rho GDP-dissociation inhibitor 2; Rho GDI 2; rho-GDI beta
UniProt Protein Name
Rho GDP-dissociation inhibitor 2
UniProt Gene Name
ARHGDIB
UniProt Synonym Gene Names
GDIA2; GDID4; RAP1GN1; Rho GDI 2
UniProt Entry Name
GDIR2_HUMAN

NCBI Description

Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010]

Uniprot Description

RhoGDI beta: regulates the GDP/GTP exchange reaction of Rho proteins by inhibiting the dissociation of GDP from them, keeping these small GTPases in an inactive state. The GDIs are made up of two domains: a flexible N-terminal domain of about 70 amino acid residues and a folded 134-residue C-terminal domain. Regulates the GTP/GDP cycling of glucose-responsive small GTPases. Its phosphorylation on Y156, S101, and S174 mediates the cycling of Cdc42 and Rac1 to regulate second-phase insulin secretion. Interacts with WNK1.

Protein type: G protein regulator, misc.; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12p12.3

Cellular Component: cytoskeleton; cytoplasm; cytoplasmic membrane-bound vesicle; cytosol

Molecular Function: Rho GDP-dissociation inhibitor activity; GTPase activator activity

Biological Process: regulation of small GTPase mediated signal transduction; regulation of catalytic activity; small GTPase mediated signal transduction; multicellular organismal development; immune response; negative regulation of cell adhesion; cell motility; actin cytoskeleton organization and biogenesis; Rho protein signal transduction; positive regulation of GTPase activity

Research Articles on ARHGDIB

Similar Products

Product Notes

The ARHGDIB arhgdib (Catalog #AAA6370271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGDIB (Rho GDP-dissociation Inhibitor 2, Rho GDI 2, Ly-GDI, Rho-GDI beta, GDIA2, GDID4, RAP1GN1) (MaxLight 490) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGDIB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARHGDIB arhgdib for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGDIB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.