Mouse anti-Human ARHGDIB Monoclonal Antibody | anti-ARHGDIB antibody

ARHGDIB (Rho GDP-dissociation Inhibitor 2, Rho GDI 2, Ly-GDI, Rho-GDI beta, GDIA2, GDID4, RAP1GN1) (FITC)

Cat. Num. AAA6145958

• Gene Names: ARHGDIB; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; RhoGDI2
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARHGDIB; Monoclonal Antibody; ARHGDIB (Rho GDP-dissociation Inhibitor 2; Rho GDI 2; Ly-GDI; Rho-GDI beta; GDIA2; GDID4; RAP1GN1) (FITC); anti-ARHGDIB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C12-B6
• Specificity: Recognizes human ARHGDIB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1204

• Applicable Applications for anti-ARHGDIB antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-201 from human ARHGDIB (AAH09200) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ARHGDIB is ~3ng/ml as a capture antibody)

Related Product Information for anti-ARHGDIB antibody

Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

Product Categories/Family for anti-ARHGDIB antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33872223
• NCBI GeneID: 397
• NCBI Official Full Name: Homo sapiens Rho GDP dissociation inhibitor (GDI) beta, mRNA
• NCBI Official Synonym Full Names: Rho GDP dissociation inhibitor beta
• NCBI Official Symbol: ARHGDIB
• NCBI Official Synonym Symbols: D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; RhoGDI2
• NCBI Protein Information: rho GDP-dissociation inhibitor 2
• Protein Family: Rho GDP-dissociation inhibitor

NCBI Description

Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010]