Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ALG5 expression in transfected 293T cell line by ALG5 polyclonal antibody. Lane 1: ALG5 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ALG5 Polyclonal Antibody | anti-ALG5 antibody

ALG5 (Dolichyl-phosphate beta-glucosyltransferase, DolP-glucosyltransferase, Asparagine-linked Glycosylation Protein 5 Homolog, HSPC149, RP11-421P11.2, bA421P11.2) APC

Gene Names
ALG5; bA421P11.2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALG5; Polyclonal Antibody; ALG5 (Dolichyl-phosphate beta-glucosyltransferase; DolP-glucosyltransferase; Asparagine-linked Glycosylation Protein 5 Homolog; HSPC149; RP11-421P11.2; bA421P11.2) APC; anti-ALG5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ALG5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
324
Applicable Applications for anti-ALG5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ALG5, aa1-324 (NP_037470.1).
Immunogen Sequence
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ALG5 expression in transfected 293T cell line by ALG5 polyclonal antibody. Lane 1: ALG5 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ALG5 expression in transfected 293T cell line by ALG5 polyclonal antibody. Lane 1: ALG5 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ALG5 antibody
This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ALG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dolichyl-phosphate beta-glucosyltransferase isoform 1
NCBI Official Synonym Full Names
ALG5 dolichyl-phosphate beta-glucosyltransferase
NCBI Official Symbol
ALG5
NCBI Official Synonym Symbols
bA421P11.2
NCBI Protein Information
dolichyl-phosphate beta-glucosyltransferase
UniProt Protein Name
Dolichyl-phosphate beta-glucosyltransferase
UniProt Gene Name
ALG5
UniProt Synonym Gene Names
DolP-glucosyltransferase

NCBI Description

This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]

Similar Products

Product Notes

The ALG5 alg5 (Catalog #AAA6369595) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALG5 (Dolichyl-phosphate beta-glucosyltransferase, DolP-glucosyltransferase, Asparagine-linked Glycosylation Protein 5 Homolog, HSPC149, RP11-421P11.2, bA421P11.2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALG5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALG5 alg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALG5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.