Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ALG2 rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in human kidney.)

Rabbit anti-Human ALG2 Polyclonal Antibody | anti-ALG2 antibody

ALG2 (Alpha-1,3/1,6-mannosyltransferase ALG2, Asparagine-linked Glycosylation Protein 2 Homolog, GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase, GDP-Man:Man(1)GlcNAc(2)-PP-dolichol Mannosyltransferase, GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1,

Gene Names
ALG2; CDGIi; NET38; hALPG2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALG2; Polyclonal Antibody; ALG2 (Alpha-1; 3/1; 6-mannosyltransferase ALG2; Asparagine-linked Glycosylation Protein 2 Homolog; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1; 3-mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol Mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1; ; anti-ALG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ALG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-ALG2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ALG2, aa1-416 (NP_149078.1).
Immunogen Sequence
MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ALG2 rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in human kidney.)

Western Blot (WB) (ALG2 rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in human kidney.)

Western Blot (WB)

(ALG2 rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in A-431.)

Western Blot (WB) (ALG2 rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of ALG2 expression in transfected 293T cell line by ALG2 polyclonal antibody. Lane 1: ALG2 transfected lysate (47.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ALG2 expression in transfected 293T cell line by ALG2 polyclonal antibody. Lane 1: ALG2 transfected lysate (47.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ALG2 antibody
This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ALG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,092 Da
NCBI Official Full Name
alpha-1,3/1,6-mannosyltransferase ALG2
NCBI Official Synonym Full Names
asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)
NCBI Official Symbol
ALG2
NCBI Official Synonym Symbols
CDGIi; NET38; hALPG2
NCBI Protein Information
alpha-1,3/1,6-mannosyltransferase ALG2; homolog of yeast ALG2; alpha-1,3-mannosyltransferase ALG2; asparagine-linked glycosylation protein 2 homolog; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosy
UniProt Protein Name
Alpha-1,3/1,6-mannosyltransferase ALG2
UniProt Gene Name
ALG2
UniProt Entry Name
ALG2_HUMAN

Similar Products

Product Notes

The ALG2 alg2 (Catalog #AAA6369586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALG2 (Alpha-1,3/1,6-mannosyltransferase ALG2, Asparagine-linked Glycosylation Protein 2 Homolog, GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase, GDP-Man:Man(1)GlcNAc(2)-PP-dolichol Mannosyltransferase, GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALG2 alg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.