Complement C5a Mouse Recombinant Protein | C5AR1 recombinant protein

Complement C5a, Recombinant Mouse

Cat. Num. AAA636890

• Gene Names: C5AR1; C5A; C5AR; C5R1; CD88
• Purity: Purified
• Synonyms: Complement C5a Mouse; Complement C5a; Recombinant Mouse; C5AR1 recombinant protein

• Host: E Coli
• Purity/Purification: Purified
• Form/Format: Supplied aa a lyophilized powder from 0.005% Tween80+2 mM reduced L-glutathion+0.2mM oxidised L-gluthation+0.1M Tris-CI buffer, pH 8.0. Reconstitute with 500uL sterile ddH20. Further dilute with PBS.
• Concentration: ~0.176 mg/mL (after reconstitution) (varies by lot)
• Sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERV; ARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR.

• Preparation and Storage: Lyophilized and reconstituted products may be stored at -20°C. Stable for 6 months after receipt at -20°C.Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for C5AR1 recombinant protein

C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a.

Recombinant corresponding to mouse C5a (6xHIS tag) expressed in E. coli.

Product Categories/Family for C5AR1 recombinant protein

Molecular Biology; MB-Complement

NCBI and Uniprot Product Information

• NCBI GI #: 14290436
• NCBI GeneID: 728
• UniProt Accession #: P21730
• Molecular Weight: 12kD
• NCBI Official Full Name: Complement component 5a receptor 1
• NCBI Official Synonym Full Names: complement component 5a receptor 1
• NCBI Official Symbol: C5AR1
• NCBI Official Synonym Symbols: C5A; C5AR; C5R1; CD88
• NCBI Protein Information: C5a anaphylatoxin chemotactic receptor 1; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1
• UniProt Protein Name: C5a anaphylatoxin chemotactic receptor 1
• Protein Family: C5a anaphylatoxin chemotactic receptor
• UniProt Gene Name: C5AR1
• UniProt Synonym Gene Names: C5AR; C5R1; C5a-R; C5aR
• UniProt Entry Name: C5AR1_HUMAN

Uniprot Description

C5aR: a family 1 G-protein coupled receptor that stimulates the GTPase activity of Gi2. Receptor for the chemotactic and inflammatory complement factor C5a. Stimulates chemotaxis, granule enzyme release and superoxide anion production. Phosphorylated in response to C5a or after stimulation of cells with phorbol esters. Expressed on monocytes, granulocytes, dendritic cells, astrocytes and microglia.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: cell surface; apical part of cell; basolateral plasma membrane; integral to plasma membrane; cytoplasmic membrane-bound vesicle; plasma membrane

Molecular Function: complement component C5a binding; complement component C5a receptor activity; C5a anaphylatoxin receptor activity

Biological Process: neutrophil chemotaxis; sensory perception of chemical stimulus; organ regeneration; activation of MAPK activity; apoptosis; response to lipopolysaccharide; signal transduction; chemotaxis; cell proliferation in hindbrain; mRNA transcription from RNA polymerase II promoter; defense response to Gram-positive bacterium; elevation of cytosolic calcium ion concentration; phospholipase C activation; response to peptidoglycan; cellular defense response; immune response; negative regulation of neuron apoptosis; inflammatory response; positive regulation of epithelial cell proliferation