Complement C5a Mouse Recombinant Protein | C5AR1 recombinant protein
Complement C5a, Recombinant Mouse
ARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR.
Recombinant corresponding to mouse C5a (6xHIS tag) expressed in E. coli.
NCBI and Uniprot Product Information
Uniprot Description
C5aR: a family 1 G-protein coupled receptor that stimulates the GTPase activity of Gi2. Receptor for the chemotactic and inflammatory complement factor C5a. Stimulates chemotaxis, granule enzyme release and superoxide anion production. Phosphorylated in response to C5a or after stimulation of cells with phorbol esters. Expressed on monocytes, granulocytes, dendritic cells, astrocytes and microglia.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR
Chromosomal Location of Human Ortholog: 19q13.3-q13.4
Cellular Component: cell surface; apical part of cell; basolateral plasma membrane; integral to plasma membrane; cytoplasmic membrane-bound vesicle; plasma membrane
Molecular Function: complement component C5a binding; complement component C5a receptor activity; C5a anaphylatoxin receptor activity
Biological Process: neutrophil chemotaxis; sensory perception of chemical stimulus; organ regeneration; activation of MAPK activity; apoptosis; response to lipopolysaccharide; signal transduction; chemotaxis; cell proliferation in hindbrain; mRNA transcription from RNA polymerase II promoter; defense response to Gram-positive bacterium; elevation of cytosolic calcium ion concentration; phospholipase C activation; response to peptidoglycan; cellular defense response; immune response; negative regulation of neuron apoptosis; inflammatory response; positive regulation of epithelial cell proliferation
Research Articles on C5AR1
Similar Products
Product Notes
The C5AR1 c5ar1 (Catalog #AAA636890) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MRGSHHHHHH GSDYDIPTTE NLYFQGGSNL HLLRQKIEEQ AAKYKHSVPK KCCYDGARVN FYETCEERV< br>ARVTIGP LCIRAFNECC TIANKIRKES PHKPVQLGR. It is sometimes possible for the material contained within the vial of "Complement C5a Mouse, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.