Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ROBO1 Monoclonal Antibody | anti-ROBO1 antibody

ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (MaxLight 750)

Gene Names
ROBO1; SAX3; DUTT1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ROBO1; Monoclonal Antibody; ROBO1 (Roundabout Homolog 1; Deleted in U Twenty Twenty; H-Robo-1; DUTT1) (MaxLight 750); anti-ROBO1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G6
Specificity
Recognizes human ROBO1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
1651
Applicable Applications for anti-ROBO1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa491-590, from human ROBO1 (NP_002932) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ROBO1 antibody
Roundabout Homolog 1 (ROBO1) is a type I transmembrane protein belonging to the ROBO family, which defines a novel subfamily of immunoglobulin superfamily proteins. ROBO family proteins are evolutionarily conserved receptors that interact with the secreted Slit proteins. ROBO-Slit interactions play an important role in axon guidance across the midline during central nervous system development. ROBO signaling also has a role in tumor angiogenesis and immune responses.
Product Categories/Family for anti-ROBO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
roundabout homolog 1 isoform a
NCBI Official Synonym Full Names
roundabout guidance receptor 1
NCBI Official Symbol
ROBO1
NCBI Official Synonym Symbols
SAX3; DUTT1
NCBI Protein Information
roundabout homolog 1
UniProt Protein Name
Roundabout homolog 1
Protein Family
UniProt Gene Name
ROBO1
UniProt Synonym Gene Names
DUTT1
UniProt Entry Name
ROBO1_HUMAN

NCBI Description

Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

ROBO1: Receptor for SLIT1 and SLIT2 which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex. May be required for lung development. Belongs to the immunoglobulin superfamily. ROBO family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p12

Cellular Component: cell surface; integral to plasma membrane; cytoplasm; plasma membrane; axolemma

Molecular Function: identical protein binding; protein binding; axon guidance receptor activity; LRR domain binding

Biological Process: caspase activation; axon guidance; nervous system development; negative regulation of negative chemotaxis; cell migration during sprouting angiogenesis; chemorepulsion involved in postnatal olfactory bulb interneuron migration; positive regulation of axonogenesis; cell adhesion; homophilic cell adhesion; axon midline choice point recognition; negative regulation of mammary gland epithelial cell proliferation

Research Articles on ROBO1

Similar Products

Product Notes

The ROBO1 robo1 (Catalog #AAA6235052) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROBO1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROBO1 robo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROBO1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.