Mouse ROBO1 Monoclonal Antibody | anti-ROBO1 antibody

ROBO1 (roundabout, axon guidance Receptor, Homolog 1 (Drosophila), DUTT1, FLJ21882, MGC131599, MGC133277, SAX3) (Biotin)

Cat. Num. AAA6172718

• Gene Names: ROBO1; SAX3; DUTT1
• Applications: Western Blot
• Purity: Purified
• Synonyms: ROBO1; Monoclonal Antibody; ROBO1 (roundabout; axon guidance Receptor; Homolog 1 (Drosophila); DUTT1; FLJ21882; MGC131599; MGC133277; SAX3) (Biotin); roundabout; SAX3; anti-ROBO1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F8
• Specificity: Recognizes ROBO1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1651

• Applicable Applications for anti-ROBO1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ROBO1 (NP_002932, 491aa-589aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ROBO1 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-ROBO1 antibody

Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-ROBO1 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 4506569
• NCBI GeneID: 6091
• NCBI Accession #: NP_002932
• NCBI GenBank Nucleotide #: NP_002932.1
• UniProt Accession #: Q9Y6N7
• NCBI Official Full Name: roundabout homolog 1 isoform a
• NCBI Official Synonym Full Names: roundabout guidance receptor 1
• NCBI Official Symbol: ROBO1
• NCBI Official Synonym Symbols: SAX3; DUTT1
• NCBI Protein Information: roundabout homolog 1
• UniProt Protein Name: Roundabout homolog 1
• Protein Family: Roundabout
• UniProt Gene Name: ROBO1
• UniProt Synonym Gene Names: DUTT1
• UniProt Entry Name: ROBO1_HUMAN

NCBI Description

Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

ROBO1: Receptor for SLIT1 and SLIT2 which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex. May be required for lung development. Belongs to the immunoglobulin superfamily. ROBO family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p12

Cellular Component: cell surface; integral to plasma membrane; cytoplasm; plasma membrane; axolemma

Molecular Function: identical protein binding; protein binding; axon guidance receptor activity; LRR domain binding

Biological Process: caspase activation; axon guidance; nervous system development; negative regulation of negative chemotaxis; cell migration during sprouting angiogenesis; chemorepulsion involved in postnatal olfactory bulb interneuron migration; positive regulation of axonogenesis; cell adhesion; homophilic cell adhesion; axon midline choice point recognition; negative regulation of mammary gland epithelial cell proliferation