Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PLCB2 Monoclonal Antibody | anti-PLCB2 antibody

PLCB2 (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase beta-2, Phosphoinositide Phospholipase C-beta-2, Phospholipase C-beta-2, PLC-beta-2, FLJ38135) (MaxLight 750)

Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLCB2; Monoclonal Antibody; PLCB2 (1-phosphatidylinositol 4; 5-bisphosphate Phosphodiesterase beta-2; Phosphoinositide Phospholipase C-beta-2; Phospholipase C-beta-2; PLC-beta-2; FLJ38135) (MaxLight 750); anti-PLCB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B3
Specificity
Recognizes human PLCB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-PLCB2 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-200 from human PLCB2 (AAH00939) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVPYKENVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKPGGAR
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PLCB2 antibody
PLCB2 is the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
Product Categories/Family for anti-PLCB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
134,024 Da
NCBI Official Full Name
Homo sapiens phospholipase C, beta 2, mRNA
NCBI Official Synonym Full Names
phospholipase C, beta 2
NCBI Official Symbol
PLCB2
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2; PLC-beta-2; phospholipase C-beta-2; phosphoinositide phospholipase C-beta-2; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
UniProt Gene Name
PLCB2
UniProt Synonym Gene Names
PLC-beta-2
UniProt Entry Name
PLCB2_HUMAN

Uniprot Description

PLCB2: The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Phospholipase; Carbohydrate Metabolism - inositol phosphate; EC 3.1.4.11

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: cytosol

Molecular Function: signal transducer activity; calcium ion binding; phosphoinositide phospholipase C activity; phospholipase C activity

Biological Process: synaptic transmission; inositol phosphate metabolic process; metabolic process; phospholipase C activation; phospholipid metabolic process; sensory perception of bitter taste; lipid catabolic process

Similar Products

Product Notes

The PLCB2 plcb2 (Catalog #AAA6234557) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLCB2 (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase beta-2, Phosphoinositide Phospholipase C-beta-2, Phospholipase C-beta-2, PLC-beta-2, FLJ38135) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLCB2 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLCB2 plcb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLCB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.