Testing Data
(Detection limit for recombinant GST tagged PLCB2 is 3ng/ml as a capture antibody.)
Mouse anti-Human PLCB2 Monoclonal Antibody | anti-PLCB2 antibody
PLCB2 (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase beta-2, Phosphoinositide Phospholipase C-beta-2, Phospholipase C-beta-2, PLC-beta-2, FLJ38135) APC
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLCB2; Monoclonal Antibody; PLCB2 (1-phosphatidylinositol 4; 5-bisphosphate Phosphodiesterase beta-2; Phosphoinositide Phospholipase C-beta-2; Phospholipase C-beta-2; PLC-beta-2; FLJ38135) APC; anti-PLCB2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B3
Specificity
Recognizes human PLCB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PLCB2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-200 from human PLCB2 (AAH00939) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVPYKENVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKPGGAR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PLCB2 is 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PLCB2 is 3ng/ml as a capture antibody.)
Related Product Information for anti-PLCB2 antibody
PLCB2 is the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
Product Categories/Family for anti-PLCB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
134,024 Da
NCBI Official Full Name
Homo sapiens phospholipase C, beta 2, mRNA
NCBI Official Synonym Full Names
phospholipase C, beta 2
NCBI Official Symbol
PLCB2
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2; PLC-beta-2; phospholipase C-beta-2; phosphoinositide phospholipase C-beta-2; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
Protein Family
UniProt Gene Name
PLCB2
UniProt Synonym Gene Names
PLC-beta-2
UniProt Entry Name
PLCB2_HUMAN
Uniprot Description
PLCB2: The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Phospholipase; Carbohydrate Metabolism - inositol phosphate; EC 3.1.4.11
Chromosomal Location of Human Ortholog: 15q15
Cellular Component: cytosol
Molecular Function: signal transducer activity; calcium ion binding; phosphoinositide phospholipase C activity; phospholipase C activity
Biological Process: synaptic transmission; inositol phosphate metabolic process; metabolic process; phospholipase C activation; phospholipid metabolic process; sensory perception of bitter taste; lipid catabolic process
Similar Products
Product Notes
The PLCB2 plcb2 (Catalog #AAA6138296) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLCB2 (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase beta-2, Phosphoinositide Phospholipase C-beta-2, Phospholipase C-beta-2, PLC-beta-2, FLJ38135) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLCB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLCB2 plcb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLCB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
