Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Myosin Light Chain 6B Monoclonal Antibody | anti-MYL6B antibody

Myosin Light Chain 6B (Smooth Muscle And Nonmuscle Myosin Light Chain Alkali 6B, Myosin Light Chain 1 Slow-Twitch Muscle A Isoform, MLC1sa, MYL6B, MLC1SA) (MaxLight 750)

Gene Names
MYL6B; MLC1SA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Myosin Light Chain 6B; Monoclonal Antibody; Myosin Light Chain 6B (Smooth Muscle And Nonmuscle Myosin Light Chain Alkali 6B; Myosin Light Chain 1 Slow-Twitch Muscle A Isoform; MLC1sa; MYL6B; MLC1SA) (MaxLight 750); anti-MYL6B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4G11
Specificity
Recognizes human MLC1SA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-MYL6B antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa109-209 from human MLC1SA (NP_002466) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MYL6B antibody
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq]
Product Categories/Family for anti-MYL6B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.2 kDa (231aa), confirmed by MALDI-TOF
NCBI Official Full Name
myosin light chain 6B
NCBI Official Synonym Full Names
myosin light chain 6B
NCBI Official Symbol
MYL6B
NCBI Official Synonym Symbols
MLC1SA
NCBI Protein Information
myosin light chain 6B
UniProt Protein Name
Myosin light chain 6B
Protein Family
UniProt Gene Name
MYL6B
UniProt Synonym Gene Names
MLC1SA; MLC1sa
UniProt Entry Name
MYL6B_HUMAN

NCBI Description

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]

Uniprot Description

MYL6B: Regulatory light chain of myosin. Does not bind calcium.

Protein type: Contractile; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: unconventional myosin complex; muscle myosin complex; myosin complex; cytosol

Molecular Function: protein binding; structural constituent of muscle; motor activity; calcium ion binding

Biological Process: skeletal muscle development; muscle contraction; metabolic process; muscle filament sliding

Research Articles on MYL6B

Similar Products

Product Notes

The MYL6B myl6b (Catalog #AAA6234026) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Myosin Light Chain 6B (Smooth Muscle And Nonmuscle Myosin Light Chain Alkali 6B, Myosin Light Chain 1 Slow-Twitch Muscle An Isoform, MLC1sa, MYL6B, MLC1SA) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Myosin Light Chain 6B can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYL6B myl6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Myosin Light Chain 6B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.