Western Blot (WB)
(MYL6B rabbit polyclonal antibody. Western Blot analysis of MYL6B expression in mouse testis.)
Rabbit anti-Human, Mouse Myosin Light Chain 6B Polyclonal Antibody | anti-MYL6B antibody
Myosin Light Chain 6B (Smooth Muscle And Nonmuscle Myosin Light Chain Alkali 6B, Myosin Light Chain 1 Slow-Twitch Muscle A Isoform, MLC1sa, MYL6B, MLC1SA) (PE)
Gene Names
MYL6B; MLC1SA
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Myosin Light Chain 6B; Polyclonal Antibody; Myosin Light Chain 6B (Smooth Muscle And Nonmuscle Myosin Light Chain Alkali 6B; Myosin Light Chain 1 Slow-Twitch Muscle A Isoform; MLC1sa; MYL6B; MLC1SA) (PE); anti-MYL6B antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MYL6B. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
208
Applicable Applications for anti-MYL6B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MYL6B, aa1-208 (NP_002466.1).
Immunogen Sequence
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(MYL6B rabbit polyclonal antibody. Western Blot analysis of MYL6B expression in mouse testis.)
Western Blot (WB)
(MYL6B rabbit polyclonal antibody. Western Blot analysis of MYL6B expression in mouse testis.)
Western Blot (WB)
(Western Blot analysis of MYL6B expression in transfected 293T cell line by MYL6B polyclonal antibody. Lane 1: MYL6B transfected lysate (22.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MYL6B expression in transfected 293T cell line by MYL6B polyclonal antibody. Lane 1: MYL6B transfected lysate (22.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MYL6B antibody
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq]
Product Categories/Family for anti-MYL6B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
myosin light chain 6B
NCBI Official Synonym Full Names
myosin light chain 6B
NCBI Official Symbol
MYL6B
NCBI Official Synonym Symbols
MLC1SA
NCBI Protein Information
myosin light chain 6B
UniProt Protein Name
Myosin light chain 6B
Protein Family
UniProt Gene Name
MYL6B
UniProt Synonym Gene Names
MLC1SA; MLC1sa
UniProt Entry Name
MYL6B_HUMAN
NCBI Description
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]
Uniprot Description
MYL6B: Regulatory light chain of myosin. Does not bind calcium.
Protein type: Contractile; Motility/polarity/chemotaxis
Chromosomal Location of Human Ortholog: 12q13.13
Cellular Component: unconventional myosin complex; muscle myosin complex; myosin complex; cytosol
Molecular Function: protein binding; structural constituent of muscle; motor activity; calcium ion binding
Biological Process: skeletal muscle development; muscle contraction; metabolic process; muscle filament sliding
Research Articles on MYL6B
Similar Products
Product Notes
The MYL6B myl6b (Catalog #AAA6386379) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Myosin Light Chain 6B (Smooth Muscle And Nonmuscle Myosin Light Chain Alkali 6B, Myosin Light Chain 1 Slow-Twitch Muscle An Isoform, MLC1sa, MYL6B, MLC1SA) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Myosin Light Chain 6B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYL6B myl6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Myosin Light Chain 6B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
