Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MAP1LC3A Monoclonal Antibody | anti-MAP1LC3A antibody

MAP1LC3A (Microtubule-associated Proteins 1A/1B Light Chain 3A, Autophagy-related Protein LC3 A, Autophagy-related Ubiquitin-like Modifier LC3 A, MAP1 Light Chain 3-like Protein 1, MAP1A/MAP1B Light Chain 3 A, MAP1A/MAP1B LC3 A, Microtubule-associated Pro

Gene Names
MAP1LC3A; LC3; LC3A; ATG8E; MAP1ALC3; MAP1BLC3
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP1LC3A; Monoclonal Antibody; MAP1LC3A (Microtubule-associated Proteins 1A/1B Light Chain 3A; Autophagy-related Protein LC3 A; Autophagy-related Ubiquitin-like Modifier LC3 A; MAP1 Light Chain 3-like Protein 1; MAP1A/MAP1B Light Chain 3 A; MAP1A/MAP1B LC3 A; Microtubule-associated Pro; anti-MAP1LC3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D5
Specificity
Recognizes human MAP1LC3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-MAP1LC3A antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-103 from human MAP1LC3A (NP_115903) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MAP1LC3A antibody
Involved in formation of autophagosomal vacuoles (autophagosomes).
Product Categories/Family for anti-MAP1LC3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 13 kDa

Observed: 18 kDa
NCBI Official Full Name
microtubule-associated proteins 1A/1B light chain 3A isoform a
NCBI Official Synonym Full Names
microtubule-associated protein 1 light chain 3 alpha
NCBI Official Symbol
MAP1LC3A
NCBI Official Synonym Symbols
LC3; LC3A; ATG8E; MAP1ALC3; MAP1BLC3
NCBI Protein Information
microtubule-associated proteins 1A/1B light chain 3A; MAP1A/MAP1B LC3 A; MAP1A/1B light chain 3 A; MAP1A/MAP1B light chain 3 A; MAP1 light chain 3-like protein 1; autophagy-related ubiquitin-like modifier LC3 A
UniProt Protein Name
Microtubule-associated proteins 1A/1B light chain 3A
UniProt Gene Name
MAP1LC3A
UniProt Synonym Gene Names
MAP1A/MAP1B LC3 A
UniProt Entry Name
MLP3A_HUMAN

NCBI Description

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis. [provided by RefSeq, Feb 2012]

Uniprot Description

LC3A: is a ubiquitin-like protein that is a constituent of the ATG8-conjugation system, one of two evolutionarily conserved phosphatidylethanolamine conjugation systems necessary for the formation of the autophagosome. The human ATG8 system includes seven ubiquitin-like light chain proteins (LCPs) that are homologs of yeast LC3: MAP1LC3A, -B, -C, GABARAP, GABARAPL1, -2, and -3. Pro-LCPs are cleaved by ATG4B to expose a C-terminal glycine residue, the cytosolic LCP-I form. The exposed C-terminus is conjugated to the head group amine of phosphatidylethanolamine (PE) through an amide bond by a sequence of ubiquitination-like reactions that involves an E1 (ATG7), an E2 (ATG3), and an E3 (a complex including ATG5, ATG12, and ATG16L). The PE-congugated form (LCP-II) is tightly associated with the autophagosomal membrane. The LCP-II forms can also be delipidated by the ATG4 proteases: most of the LCPs are delipidated and liberated from the membrane before autophagosomes fuse with lysosomes. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Microtubule-binding; Ubiquitin-like modifier; Autophagy; Vesicle

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: microtubule; extrinsic to membrane; late endosome; autophagic vacuole; cytoplasmic vesicle; cytosol

Molecular Function: protein binding; phosphatidylethanolamine binding; microtubule binding; GABA receptor binding; phospholipid binding

Biological Process: mitochondrion degradation; cellular response to nitrogen starvation; autophagic vacuole formation

Research Articles on MAP1LC3A

Similar Products

Product Notes

The MAP1LC3A map1lc3a (Catalog #AAA6233757) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP1LC3A (Microtubule-associated Proteins 1A/1B Light Chain 3A, Autophagy-related Protein LC3 A, Autophagy-related Ubiquitin-like Modifier LC3 A, MAP1 Light Chain 3-like Protein 1, MAP1A/MAP1B Light Chain 3 A, MAP1A/MAP1B LC3 A, Microtubule-associated Pro reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP1LC3A can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP1LC3A map1lc3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP1LC3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.