Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MAP Kinase 4 Monoclonal Antibody | anti-MAPK4 antibody

MAP Kinase 4 (Mitogen-activated Protein Kinase 4, MAPK 4, MAPK4, Extracellular Signal-regulated Kinase 4, ERK4, ERK-4, MAP Kinase Isoform p63, p63-MAPK, p63MAPK, PRKM4) (MaxLight 750)

Gene Names
MAPK4; ERK4; ERK-4; PRKM4; p63MAPK; p63-MAPK
Reactivity
Human
Applications
Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP Kinase 4; Monoclonal Antibody; MAP Kinase 4 (Mitogen-activated Protein Kinase 4; MAPK 4; MAPK4; Extracellular Signal-regulated Kinase 4; ERK4; ERK-4; MAP Kinase Isoform p63; p63-MAPK; p63MAPK; PRKM4) (MaxLight 750); anti-MAPK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Specificity
Recognizes human MAPK4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-MAPK4 antibody
FLISA, Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa42-152, from human MAPK4 (NP_002738) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHSANVLHRDLK
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-MAPK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,922 Da
NCBI Official Full Name
mitogen-activated protein kinase 4 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 4
NCBI Official Symbol
MAPK4
NCBI Official Synonym Symbols
ERK4; ERK-4; PRKM4; p63MAPK; p63-MAPK
NCBI Protein Information
mitogen-activated protein kinase 4; Erk3-related; MAP kinase isoform p63; MAPK 4; extracellular signal-regulated kinase 4
UniProt Protein Name
Mitogen-activated protein kinase 4
UniProt Gene Name
MAPK4
UniProt Synonym Gene Names
ERK4; PRKM4; MAP kinase 4; MAPK 4; ERK-4; p63-MAPK
UniProt Entry Name
MK04_HUMAN

Similar Products

Product Notes

The MAPK4 mapk4 (Catalog #AAA6233755) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP Kinase 4 (Mitogen-activated Protein Kinase 4, MAPK 4, MAPK4, Extracellular Signal-regulated Kinase 4, ERK4, ERK-4, MAP Kinase Isoform p63, p63-MAPK, p63MAPK, PRKM4) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP Kinase 4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPK4 mapk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP Kinase 4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.