Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CEACAM1 Monoclonal Antibody | anti-CEACAM1 antibody

CEACAM1 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP1, BGP-1, BGP, BGPI, CD66a) (MaxLight 750)

Gene Names
CEACAM1; BGP; BGP1; BGPI
Reactivity
Human
Applications
FLISA
Purity
Purified
Synonyms
CEACAM1; Monoclonal Antibody; CEACAM1 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 1; Biliary Glycoprotein 1; BGP1; BGP-1; BGP; BGPI; CD66a) (MaxLight 750); anti-CEACAM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F10
Specificity
Recognizes human CEACAM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CEACAM1 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa305-414 from human CEACAM1 (AAH14473) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CEACAM1 antibody
CD66a is a member of the carcinoembryonic antigen (CEA) family and is expressed by hematopoietic cells. It is also expressed on apical membranes of some epithelia, on endothelium of certain organs and on cells of myeloid lineage, granulocytes and myelocytes. Interestingly, it has been reported to be downregulated in some cancers. This antibody will help detect CD66a expression in a variety of tissues.
Product Categories/Family for anti-CEACAM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
634
Molecular Weight
39,871 Da
NCBI Official Full Name
Homo sapiens carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein), mRNA
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 1
NCBI Official Symbol
CEACAM1
NCBI Official Synonym Symbols
BGP; BGP1; BGPI
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 1
Protein Family

NCBI Description

This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of all variants has not been defined. [provided by RefSeq, May 2010]

Research Articles on CEACAM1

Similar Products

Product Notes

The CEACAM1 (Catalog #AAA6232097) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CEACAM1 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP1, BGP-1, BGP, BGPI, CD66a) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM1 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CEACAM1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CEACAM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.