Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse PRDM4 Monoclonal Antibody | anti-PRDM4 antibody

PRDM4 (PR Domain Containing 4, MGC45046, PFM1) (MaxLight 650)

Gene Names
PRDM4; PFM1
Applications
Immunofluorescence
Purity
Purified
Synonyms
PRDM4; Monoclonal Antibody; PRDM4 (PR Domain Containing 4; MGC45046; PFM1) (MaxLight 650); PR Domain Containing 4; PFM1; anti-PRDM4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C11
Specificity
Recognizes PRDM4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-PRDM4 antibody
FLISA, Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PRDM4 (NP_036538, 476aa-575aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PRDM4 antibody
The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. An elevated expression level of this gene has been observed in PC12 cells treated with nerve growth factor, beta polypeptide (NGF). This gene is located in a chromosomal region that is thought to contain tumor suppressor genes. [provided by RefSeq]
Product Categories/Family for anti-PRDM4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
PR domain zinc finger protein 4
NCBI Official Synonym Full Names
PR/SET domain 4
NCBI Official Symbol
PRDM4
NCBI Official Synonym Symbols
PFM1
NCBI Protein Information
PR domain zinc finger protein 4
UniProt Protein Name
PR domain zinc finger protein 4
UniProt Gene Name
PRDM4
UniProt Synonym Gene Names
PFM1
UniProt Entry Name
PRDM4_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. An elevated expression level of this gene has been observed in PC12 cells treated with nerve growth factor, beta polypeptide (NGF). This gene is located in a chromosomal region that is thought to contain tumor suppressor genes. [provided by RefSeq, Jul 2008]

Uniprot Description

PRDM4: May function as a transcription factor involved in cell differentiation.

Protein type: Methyltransferase, protein lysine, predicted; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 12q23-q24.1

Cellular Component: nucleus

Molecular Function: methyltransferase activity; DNA binding; zinc ion binding

Biological Process: transcription from RNA polymerase II promoter; methylation; cell proliferation; nerve growth factor receptor signaling pathway; regulation of transcription, DNA-dependent; signal transduction; negative regulation of cell cycle

Research Articles on PRDM4

Similar Products

Product Notes

The PRDM4 prdm4 (Catalog #AAA6229395) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRDM4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRDM4 prdm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRDM4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.