Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse CUTL1 Monoclonal Antibody | anti-CUTL1 antibody

CUTL1 (cut-like Homeobox 1, CASP, CDP, CDP/Cut, CDP1, COY1, CUTL1, CUX, Clox, Cux/CDP, GOLIM6, Nbla10317, p100, p110, p200, p75) (MaxLight 650)

Gene Names
CUX1; CDP; CUX; p75; CASP; CDP1; COY1; Clox; p100; p110; p200; CUTL1; GOLIM6; CDP/Cut; Cux/CDP; Nbla10317
Applications
Western Blot
Purity
Purified
Synonyms
CUTL1; Monoclonal Antibody; CUTL1 (cut-like Homeobox 1; CASP; CDP; CDP/Cut; CDP1; COY1; CUX; Clox; Cux/CDP; GOLIM6; Nbla10317; p100; p110; p200; p75) (MaxLight 650); cut-like Homeobox 1; p75; anti-CUTL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D10
Specificity
Recognizes CUTL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CUTL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CUTL1 (NP_001904.2, 521aa-620aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CUTL1 antibody
The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]
Product Categories/Family for anti-CUTL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,644 Da
NCBI Official Full Name
protein CASP isoform b
NCBI Official Synonym Full Names
cut-like homeobox 1
NCBI Official Symbol
CUX1
NCBI Official Synonym Symbols
CDP; CUX; p75; CASP; CDP1; COY1; Clox; p100; p110; p200; CUTL1; GOLIM6; CDP/Cut; Cux/CDP; Nbla10317
NCBI Protein Information
protein CASP; cut homolog; homeobox protein cux-1; CCAAT displacement protein; golgi integral membrane protein 6; putative protein product of Nbla10317
UniProt Protein Name
Protein CASP
UniProt Gene Name
CUX1
UniProt Synonym Gene Names
CUTL1
UniProt Entry Name
CASP_HUMAN

NCBI Description

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Feb 2011]

Uniprot Description

CUTL1 iso1: Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Belongs to the CUT homeobox family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: integral to Golgi membrane; cytosol; nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding

Biological Process: regulation of transcription from RNA polymerase II promoter; intra-Golgi vesicle-mediated transport; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; auditory receptor cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of dendrite morphogenesis; kidney development; lung development

Research Articles on CUTL1

Similar Products

Product Notes

The CUTL1 cux1 (Catalog #AAA6227143) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CUTL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CUTL1 cux1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CUTL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.