Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse COL8A2 Monoclonal Antibody | anti-COL8A2 antibody

COL8A2 (Collagen, Type VIII, alpha 2, FECD, FLJ00201, MGC116970, MGC116972, PPCD, PPCD2) (MaxLight 650)

Gene Names
COL8A2; FECD; PPCD; FECD1; PPCD2
Applications
Western Blot
Purity
Purified
Synonyms
COL8A2; Monoclonal Antibody; COL8A2 (Collagen; Type VIII; alpha 2; FECD; FLJ00201; MGC116970; MGC116972; PPCD; PPCD2) (MaxLight 650); Collagen; PPCD2; anti-COL8A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F4
Specificity
Recognizes COL8A2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-COL8A2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
COL8A2 (NP_005193.1, 626aa-696aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-COL8A2 antibody
Mouse monoclonal antibody raised against a partial recombinant COL8A2.
Product Categories/Family for anti-COL8A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,244 Da
NCBI Official Full Name
collagen alpha-2(VIII) chain
NCBI Official Synonym Full Names
collagen, type VIII, alpha 2
NCBI Official Symbol
COL8A2
NCBI Official Synonym Symbols
FECD; PPCD; FECD1; PPCD2
NCBI Protein Information
collagen alpha-2(VIII) chain; collagen alpha-2(VIII) chain; endothelial collagen; collagen type VIII alpha 2; collagen VIII, alpha-2 polypeptide; dJ665N4.1 (collagen type VIII alpha 2)
UniProt Protein Name
Collagen alpha-2(VIII) chain
UniProt Gene Name
COL8A2
UniProt Entry Name
CO8A2_HUMAN

NCBI Description

This gene encodes the alpha 2 chain of type VIII collagen. The protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2. [provided by RefSeq, Dec 2009]

Uniprot Description

COL8A2: Macromolecular component of the subendothelium. Major component of the Descemet's membrane (basement membrane) of corneal endothelial cells. Also component of the endothelia of blood vessels. Necessary for migration and proliferation of vascular smooth muscle cells and thus, has a potential role in the maintenance of vessel wall integrity and structure, in particular in atherogenesis. Defects in COL8A2 are the cause of corneal dystrophy Fuchs endothelial type 1 (FECD1). It is an ocular disorder caused by loss of endothelium of the central cornea. It is characterized by focal wart-like guttata that arise from Descemet membrane and develop in the central cornea, epithelial blisters, reduced vision and pain. Descemet membrane is thickened by abnormal collagenous deposition. Defects in COL8A2 are the cause of posterior polymorphous corneal dystrophy type 2 (PPCD2). PPCD is a rare bilateral familial disorder of the corneal epithelium, and is inherited in a autosomal dominant pattern. The clinical features usually present earlier than FECD, being from birth onwards. The disorder is characterized by alterations of Descemet membrane presenting as vesicles, opacities or band-like lesions on slit- lamp examination and specular microscopy. Affected patient typically are asymptomatic.

Protein type: Extracellular matrix; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1p34.2

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; collagen; endoplasmic reticulum lumen; extracellular region; basement membrane

Molecular Function: protein binding, bridging; extracellular matrix structural constituent

Biological Process: collagen catabolic process; extracellular matrix disassembly; epithelial cell proliferation; cell-cell adhesion; extracellular matrix organization and biogenesis; camera-type eye morphogenesis; angiogenesis

Disease: Corneal Dystrophy, Posterior Polymorphous, 2; Corneal Dystrophy, Fuchs Endothelial, 1

Research Articles on COL8A2

Similar Products

Product Notes

The COL8A2 col8a2 (Catalog #AAA6227054) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's COL8A2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COL8A2 col8a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COL8A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.