Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse BUB1B Monoclonal Antibody | anti-BUB1B antibody

BUB1B (Budding Uninhibited by Benzimidazoles 1 Homolog beta (yeast), BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1) (MaxLight 650)

Gene Names
BUB1B; MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
BUB1B; Monoclonal Antibody; BUB1B (Budding Uninhibited by Benzimidazoles 1 Homolog beta (yeast); BUB1beta; BUBR1; Bub1A; MAD3L; SSK1; hBUBR1) (MaxLight 650); Budding Uninhibited by Benzimidazoles 1 Homolog beta (yeast); hBUBR1; anti-BUB1B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G9
Specificity
Recognizes BUB1B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
1050
Applicable Applications for anti-BUB1B antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BUB1B (AAH18739, 1aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-BUB1B antibody
This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq]
Product Categories/Family for anti-BUB1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
701
NCBI Official Full Name
Budding uninhibited by benzimidazoles 1 homolog beta (yeast)
NCBI Official Synonym Full Names
BUB1 mitotic checkpoint serine/threonine kinase B
NCBI Official Symbol
BUB1B
NCBI Official Synonym Symbols
MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
NCBI Protein Information
mitotic checkpoint serine/threonine-protein kinase BUB1 beta

NCBI Description

This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq, Jul 2008]

Research Articles on BUB1B

Similar Products

Product Notes

The BUB1B (Catalog #AAA6226741) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BUB1B can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BUB1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BUB1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.