Mouse ABTB1 Monoclonal Antibody | anti-ABTB1 antibody
ABTB1 (Ankyrin Repeat and BTB (POZ) Domain Containing 1, BPOZ, Btb3, EF1ABP, MGC20585, PP2259) (MaxLight 650)
Applications
Immunofluorescence
Purity
Purified
Synonyms
ABTB1; Monoclonal Antibody; ABTB1 (Ankyrin Repeat and BTB (POZ) Domain Containing 1; BPOZ; Btb3; EF1ABP; MGC20585; PP2259) (MaxLight 650); Ankyrin Repeat and BTB (POZ) Domain Containing 1; PP2259; anti-ABTB1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A10
Specificity
Recognizes ABTB1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
478
Applicable Applications for anti-ABTB1 antibody
FLISA, Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ABTB1 (NP_742024, 271aa-370aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ABTB1 antibody
This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants encoding different isoforms. [provided by RefSeq]
Product Categories/Family for anti-ABTB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ankyrin repeat and BTB/POZ domain-containing protein 1 isoform 2
UniProt Protein Name
Ankyrin repeat and BTB/POZ domain-containing protein 1
Protein Family
UniProt Gene Name
ABTB1
UniProt Synonym Gene Names
BPOZ
UniProt Entry Name
ABTB1_HUMAN
Similar Products
Product Notes
The ABTB1 abtb1 (Catalog #AAA6226392) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ABTB1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABTB1 abtb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABTB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
