Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SERCA1 Monoclonal Antibody | anti-SERCA1 antibody

SERCA1 (ATP2A1, ATPase, Ca++ transporting, Cardiac Muscle, Fast Twitch 1, ATP2A, OTTHUMP00000162562, SR Ca(2+)-ATPase 1, Calcium pump 1, Calcium-transporting ATPase sarcoplasmic reticulum Type, Fast Twitch skeletal Muscle isoform, Endoplasmic reticulum cl

Gene Names
atp2a1; atp2a; atp2a2; serca1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
SERCA1; Monoclonal Antibody; SERCA1 (ATP2A1; ATPase; Ca++ transporting; Cardiac Muscle; Fast Twitch 1; ATP2A; OTTHUMP00000162562; SR Ca(2+)-ATPase 1; Calcium pump 1; Calcium-transporting ATPase sarcoplasmic reticulum Type; Fast Twitch skeletal Muscle isoform; Endoplasmic reticulum cl; anti-SERCA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F8
Specificity
Recognizes human ATP2A1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SERCA1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa522-612 from human ATP2A1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SERCA1 antibody
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms.
Product Categories/Family for anti-SERCA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW 110kDa
NCBI Official Full Name
ATPase, Ca++ transporting, slow twitch 2
NCBI Official Synonym Full Names
ATPase, Ca++ transporting, cardiac muscle, fast twitch 1<
NCBI Official Symbol
atp2a1
NCBI Official Synonym Symbols
atp2a; atp2a2; serca1
NCBI Protein Information
ATPase, Ca++ transporting, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
UniProt Protein Name
Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
UniProt Gene Name
ATP2A1
UniProt Synonym Gene Names
SERCA1
UniProt Entry Name
AT2A1_HUMAN

Uniprot Description

ATP2A1: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Associated with sarcolipin (SLN) and phospholamban (PLN). Increased contractile activity leads to a decrease in SERCA1 expression, while decreased contractile activity leads to an increase in SERCA1 expression. Skeletal muscle, fast twitch muscle (type II) fibers. Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Hydrolase; Transporter, ion channel; EC 3.6.3.8; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: I band; endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; membrane; sarcoplasmic reticulum; perinuclear region of cytoplasm; integral to membrane; ER-Golgi intermediate compartment

Molecular Function: protein binding; protein homodimerization activity; calcium-transporting ATPase activity; calcium ion binding; ATP binding

Biological Process: apoptotic mitochondrial changes; positive regulation of fast-twitch skeletal muscle contraction; maintenance of mitochondrion localization; metabolic process; reduction of endoplasmic reticulum calcium ion concentration; calcium ion transport; elevation of endoplasmic reticulum calcium ion concentration; regulation of striated muscle contraction; blood coagulation; transmembrane transport; negative regulation of striated muscle contraction; elevation of mitochondrial calcium ion concentration

Disease: Brody Myopathy

Research Articles on SERCA1

Similar Products

Product Notes

The SERCA1 atp2a1 (Catalog #AAA6226299) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SERCA1 (ATP2A1, ATPase, Ca++ transporting, Cardiac Muscle, Fast Twitch 1, ATP2A, OTTHUMP00000162562, SR Ca(2+)-ATPase 1, Calcium pump 1, Calcium-transporting ATPase sarcoplasmic reticulum Type, Fast Twitch skeletal Muscle isoform, Endoplasmic reticulum cl reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERCA1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERCA1 atp2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERCA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.