Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC12A2 Monoclonal Antibody | anti-SLC12A2 antibody

SLC12A2 (Solute Carrier Family 12 Member 2, Basolateral Na-K-Cl Symporter, Bumetanide-sensitive Sodium-(potassium)-chloride Cotransporter 1, NKCC1, MGC104233) (MaxLight 650)

Gene Names
SLC12A2; BSC; BSC2; NKCC1; PPP1R141
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC12A2; Monoclonal Antibody; SLC12A2 (Solute Carrier Family 12 Member 2; Basolateral Na-K-Cl Symporter; Bumetanide-sensitive Sodium-(potassium)-chloride Cotransporter 1; NKCC1; MGC104233) (MaxLight 650); anti-SLC12A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5H7
Specificity
Recognizes human SLC12A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SLC12A2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa903-1011 from human SLC12A2 (NP_001037) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC12A2 antibody
Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.
Product Categories/Family for anti-SLC12A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
129,679 Da
NCBI Official Full Name
solute carrier family 12 member 2 isoform 1
NCBI Official Synonym Full Names
solute carrier family 12 (sodium/potassium/chloride transporter), member 2
NCBI Official Symbol
SLC12A2
NCBI Official Synonym Symbols
BSC; BSC2; NKCC1; PPP1R141
NCBI Protein Information
solute carrier family 12 member 2; basolateral Na-K-Cl symporter; protein phosphatase 1, regulatory subunit 141; bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1; solute carrier family 12 (sodium/potassium/chloride transporters), member 2
UniProt Protein Name
Solute carrier family 12 member 2
Protein Family
UniProt Gene Name
SLC12A2
UniProt Synonym Gene Names
NKCC1
UniProt Entry Name
S12A2_HUMAN

NCBI Description

The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

NKCC1: a multi-pass membrane cation transporter protein. Aids transcellular movement of chloride across both secretory and absorptive epithelia. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume. Expressed in many tissues. Bumetanide is a potent NKCC1 antagonist. Two alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family; Transporter

Chromosomal Location of Human Ortholog: 5q23.3

Cellular Component: membrane; basolateral plasma membrane; integral to plasma membrane; apical plasma membrane; plasma membrane; vesicle

Molecular Function: protein binding; ammonium transmembrane transporter activity; sodium:potassium:chloride symporter activity

Biological Process: hyperosmotic response; transport; multicellular organism growth; transepithelial chloride transport; sodium ion transport; ion transport; detection of mechanical stimulus involved in sensory perception of sound; positive regulation of cell volume; transmembrane transport; gamma-aminobutyric acid signaling pathway; potassium ion transport; ammonium transport

Research Articles on SLC12A2

Similar Products

Product Notes

The SLC12A2 slc12a2 (Catalog #AAA6224667) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC12A2 (Solute Carrier Family 12 Member 2, Basolateral Na-K-Cl Symporter, Bumetanide-sensitive Sodium-(potassium)-chloride Cotransporter 1, NKCC1, MGC104233) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC12A2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC12A2 slc12a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC12A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.