Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RING Finger Protein 40 Monoclonal Antibody | anti-RNF40 antibody

RING Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING) (MaxLight 650)

Gene Names
RNF40; BRE1B; RBP95; STARING
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 40; Monoclonal Antibody; RING Finger Protein 40 (RNF40; 95kD Retinoblastoma Protein Binding Protein; BRE1B; BRE1-B; DKFZp686K191; E3 Ubiquitin Protein Ligase BRE1B; KIAA0661; MGC13051; Rb-associated Protein; RBP95; STARING) (MaxLight 650); anti-RNF40 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C1
Specificity
Recognizes human RNF40.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
5309
Applicable Applications for anti-RNF40 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa102-200 (NP_055586) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RNF40 antibody
The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery.
Product Categories/Family for anti-RNF40 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ring finger protein 40 (RNF40), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ring finger protein 40
NCBI Official Symbol
RNF40
NCBI Official Synonym Symbols
BRE1B; RBP95; STARING
NCBI Protein Information
E3 ubiquitin-protein ligase BRE1B
UniProt Protein Name
E3 ubiquitin-protein ligase BRE1B
UniProt Gene Name
RNF40
UniProt Synonym Gene Names
BRE1B; KIAA0661; BRE1-B; RBP95
UniProt Entry Name
BRE1B_HUMAN

NCBI Description

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Uniprot Description

RNF40: Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role in histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Component of the RNF20/40 complex (also known as BRE1 complex) probably composed of 2 copies of RNF20/BRE1A and 2 copies of RNF40/BRE1B. Interacts with UBE2E1/UBCH6. Interacts with RB1 and WAC. Ubiquitously expressed. Expressed at higher level in testis, heart and pancreas, while it is only weakly expressed in lung, skeletal muscle and small intestine. Belongs to the BRE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ligase; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 16p11.2-p11.1

Cellular Component: nucleoplasm; neuron projection; membrane; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; protein homodimerization activity; mRNA 3'-UTR binding; zinc ion binding; ubiquitin protein ligase binding; protein complex binding; syntaxin-1 binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: histone monoubiquitination; ubiquitin-dependent protein catabolic process; regulation of mitotic cell cycle; histone H2B ubiquitination

Research Articles on RNF40

Similar Products

Product Notes

The RNF40 rnf40 (Catalog #AAA6224320) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 40 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF40 rnf40 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 40, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.