Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PPP2R2C Monoclonal Antibody | anti-PPP2R2C antibody

PPP2R2C (Serine/threonine-protein Phosphatase 2A 55kD Regulatory Subunit B gamma Isoform, PP2A Subunit B Isoform gamma, PP2A Subunit B Isoform B55-gamma, PP2A Subunit B Isoform PR55-gamma, PP2A Subunit B Isoform R2-gamma, IMYPNO1, MGC33570) (MaxLight 650)

Gene Names
PPP2R2C; PR52; PR55G; IMYPNO; IMYPNO1; B55gamma; B55-GAMMA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP2R2C; Monoclonal Antibody; PPP2R2C (Serine/threonine-protein Phosphatase 2A 55kD Regulatory Subunit B gamma Isoform; PP2A Subunit B Isoform gamma; PP2A Subunit B Isoform B55-gamma; PP2A Subunit B Isoform PR55-gamma; PP2A Subunit B Isoform R2-gamma; IMYPNO1; MGC33570) (MaxLight 650); anti-PPP2R2C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D1
Specificity
Recognizes human PPP2R2C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
447
Applicable Applications for anti-PPP2R2C antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human PPP2R2C (NP_065149) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLST
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PPP2R2C antibody
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]
Product Categories/Family for anti-PPP2R2C antibody
References
1. Association of decreased expression of protein phosphatase 2A subunit PR55{gamma} (PPP2R2C) with an increased risk of metastases and prostate cancer-specific mortality. Spencer ES, Bluemn EG, Johnston R, Zhang X, Gordon RR, Lewinshtein D, Lucas J, Nelson P, Porter CR.J Clin Oncol (Meeting Abstracts) May 2012 vol. 30 no. 15_suppl 4669.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein phosphatase 2, regulatory subunit B, gamma isoform a
NCBI Official Synonym Full Names
protein phosphatase 2 regulatory subunit Bgamma
NCBI Official Symbol
PPP2R2C
NCBI Official Synonym Symbols
PR52; PR55G; IMYPNO; IMYPNO1; B55gamma; B55-GAMMA
NCBI Protein Information
protein phosphatase 2, regulatory subunit B, gamma
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
UniProt Gene Name
PPP2R2C
UniProt Entry Name
2ABG_HUMAN

NCBI Description

The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PPP2R2C: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Belongs to the phosphatase 2A regulatory subunit B family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 4p16.1

Cellular Component: protein phosphatase type 2A complex

Molecular Function: protein binding; protein phosphatase type 2A regulator activity

Biological Process: regulation of catalytic activity; signal transduction

Research Articles on PPP2R2C

Similar Products

Product Notes

The PPP2R2C ppp2r2c (Catalog #AAA6223991) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP2R2C (Serine/threonine-protein Phosphatase 2A 55kD Regulatory Subunit B gamma Isoform, PP2A Subunit B Isoform gamma, PP2A Subunit B Isoform B55-gamma, PP2A Subunit B Isoform PR55-gamma, PP2A Subunit B Isoform R2-gamma, IMYPNO1, MGC33570) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R2C can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP2R2C ppp2r2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP2R2C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.