Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PGM2 Monoclonal Antibody | anti-PGM2 antibody

PGM2 (Phosphoglucomutase-2, PGM 2, Glucose Phosphomutase 2, Phosphopentomutase, Phosphodeoxyribomutase, MSTP006, FLJ10983) (MaxLight 650)

Gene Names
PGM2; MSTP006
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PGM2; Monoclonal Antibody; PGM2 (Phosphoglucomutase-2; PGM 2; Glucose Phosphomutase 2; Phosphopentomutase; Phosphodeoxyribomutase; MSTP006; FLJ10983) (MaxLight 650); anti-PGM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A3
Specificity
Recognizes human PGM2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-PGM2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-90 from human PGM2 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLE
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PGM2 antibody
Catalyzes the conversion of the nucleoside breakdown products ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. May also catalyze the interconversion of glucose-1-phosphate and glucose-6-phosphate. Has low glucose 1,6-bisphosphate synthase activity.
Product Categories/Family for anti-PGM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70.7kDa (635aa)
NCBI Official Full Name
phosphoglucomutase-2
NCBI Official Synonym Full Names
phosphoglucomutase 2
NCBI Official Symbol
PGM2
NCBI Official Synonym Symbols
MSTP006
NCBI Protein Information
phosphoglucomutase-2
UniProt Protein Name
Phosphoglucomutase-2
Protein Family
UniProt Gene Name
PGM2
UniProt Synonym Gene Names
PGM 2
UniProt Entry Name
PGM2_HUMAN

Uniprot Description

PGM2: Catalyzes the conversion of the nucleoside breakdown products ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. May also catalyze the interconversion of glucose-1-phosphate and glucose-6-phosphate. Has low glucose 1,6-bisphosphate synthase activity. Belongs to the phosphohexose mutase family.

Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; Carbohydrate Metabolism - galactose; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - pentose phosphate pathway; Carbohydrate Metabolism - starch and sucrose; EC 5.4.2.2; EC 5.4.2.7; Isomerase

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: cytosol

Molecular Function: phosphoglucomutase activity; phosphopentomutase activity; protein binding

Biological Process: galactose catabolic process; glycogen biosynthetic process; glycogen catabolic process; pentose-phosphate shunt

Research Articles on PGM2

Similar Products

Product Notes

The PGM2 pgm2 (Catalog #AAA6223790) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PGM2 (Phosphoglucomutase-2, PGM 2, Glucose Phosphomutase 2, Phosphopentomutase, Phosphodeoxyribomutase, MSTP006, FLJ10983) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PGM2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGM2 pgm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.