Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human COL14A1 Monoclonal Antibody | anti-COL14A1 antibody

COL14A1 (Collagen alpha-1(XIV) Chain, Undulin, UND) (MaxLight 650)

Gene Names
COL14A1; UND
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COL14A1; Monoclonal Antibody; COL14A1 (Collagen alpha-1(XIV) Chain; Undulin; UND) (MaxLight 650); anti-COL14A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5F3
Specificity
Recognizes human COL14A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-COL14A1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa34-120 from human COL14A1 (NP_066933) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRLRYNVISHDSIQISWKAPRGKFGGYKLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-COL14A1 antibody
Plays an adhesive role by integrating collagen bundles. It is probably associated with the surface of interstitial collagen fibrils via COL1. The COL2 domain may then serve as a rigid arm which sticks out from the fibril and protrudes the large N-terminal globular domain into the extracellular space, where it might interact with other matrix molecules or cell surface receptors.
Product Categories/Family for anti-COL14A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
183,154 Da
NCBI Official Full Name
collagen alpha-1(XIV) chain
NCBI Official Synonym Full Names
collagen, type XIV, alpha 1
NCBI Official Symbol
COL14A1
NCBI Official Synonym Symbols
UND
NCBI Protein Information
collagen alpha-1(XIV) chain; collagen alpha-1(XIV) chain; COL14A1; undulin (fibronectin-tenascin-related)
UniProt Protein Name
Collagen alpha-1(XIV) chain
Protein Family
UniProt Gene Name
COL14A1
UniProt Synonym Gene Names
UND
UniProt Entry Name
COEA1_HUMAN

Uniprot Description

COL14A1: Plays an adhesive role by integrating collagen bundles. It is probably associated with the surface of interstitial collagen fibrils via COL1. The COL2 domain may then serve as a rigid arm which sticks out from the fibril and protrudes the large N-terminal globular domain into the extracellular space, where it might interact with other matrix molecules or cell surface receptors. Belongs to the fibril-associated collagens with interrupted helices (FACIT) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Extracellular matrix; Secreted

Chromosomal Location of Human Ortholog: 8q23

Cellular Component: collagen type XIV; extracellular matrix; proteinaceous extracellular matrix; extracellular space; collagen; endoplasmic reticulum lumen; extracellular region

Molecular Function: collagen binding; protein binding, bridging; extracellular matrix structural constituent

Biological Process: collagen catabolic process; extracellular matrix disassembly; cell-cell adhesion; extracellular matrix organization and biogenesis; collagen fibril organization; homeostasis of number of cells within a tissue

Similar Products

Product Notes

The COL14A1 col14a1 (Catalog #AAA6221567) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COL14A1 (Collagen alpha-1(XIV) Chain, Undulin, UND) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COL14A1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COL14A1 col14a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COL14A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.