Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse SFPQ Monoclonal Antibody | anti-SFPQ antibody

SFPQ (Splicing Factor Proline/Glutamine-Rich (polypyrimidine tract Binding Protein Associated), POMP100, PSF) (MaxLight 550)

Gene Names
SFPQ; PSF; POMP100; PPP1R140
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SFPQ; Monoclonal Antibody; SFPQ (Splicing Factor Proline/Glutamine-Rich (polypyrimidine tract Binding Protein Associated); POMP100; PSF) (MaxLight 550); Splicing Factor Proline/Glutamine-Rich (polypyrimidine tract Binding Protein Associated); PSF; anti-SFPQ antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B10
Specificity
Recognizes SFPQ.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SFPQ antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SFPQ (NP_005057, 269aa-361aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SFPQ antibody
Mouse monoclonal antibody raised against a partial recombinant SFPQ.
Product Categories/Family for anti-SFPQ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,263 Da
NCBI Official Full Name
splicing factor, proline- and glutamine-rich
NCBI Official Synonym Full Names
splicing factor proline/glutamine-rich
NCBI Official Symbol
SFPQ
NCBI Official Synonym Symbols
PSF; POMP100; PPP1R140
NCBI Protein Information
splicing factor, proline- and glutamine-rich; 100 kDa DNA-pairing protein; DNA-binding p52/p100 complex, 100 kDa subunit; PTB-associated splicing factor; PTB-associated-splicing factor; hPOMp100; polypyrimidine tract binding protein associated; polypyrimi
UniProt Protein Name
Splicing factor, proline- and glutamine-rich
Protein Family
UniProt Gene Name
SFPQ
UniProt Synonym Gene Names
PSF; hPOMp100; PSF; PTB-associated-splicing factor
UniProt Entry Name
SFPQ_HUMAN

Uniprot Description

PSF: a proline-and glutamine-rich splicing factor. Essential pre-mRNA splicing factor required early in spliceosome formation. Seems to also bind DNA. The active complex is a heterotetramer of two 52 kDa and two 100 kDa subunits. Reported to be a PKC-alpha-binding protein in the cell nucleus. Two alternatively spliced isoforms have been described.

Protein type: RNA splicing; RNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: nucleoplasm; nuclear matrix; cytoplasm; nucleus; paraspeckles; chromatin

Molecular Function: protein binding; histone deacetylase binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; RNA splicing; rhythmic process; negative regulation of circadian rhythm; negative regulation of transcription from RNA polymerase II promoter; DNA repair; mRNA processing; negative regulation of transcription, DNA-dependent; regulation of circadian rhythm; DNA recombination

Similar Products

Product Notes

The SFPQ sfpq (Catalog #AAA6219147) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SFPQ can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SFPQ sfpq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SFPQ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.