Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse MMP23B Monoclonal Antibody | anti-MMP23B antibody

MMP23B (Matrix Metallopeptidase 23B, MIFR, MIFR-1, MMP22) (MaxLight 550)

Gene Names
MMP23B; MIFR; MMP22; MIFR-1; MMP23A
Applications
FLISA
Purity
Purified
Synonyms
MMP23B; Monoclonal Antibody; MMP23B (Matrix Metallopeptidase 23B; MIFR; MIFR-1; MMP22) (MaxLight 550); Matrix Metallopeptidase 23B; MMP22; anti-MMP23B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D8
Specificity
Recognizes MMP23B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-MMP23B antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MMP23B (NP_008914, 241aa-340aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEP
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MMP23B antibody
This gene (MMP23B) encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. This gene belongs to the more telomeric copy of the duplicated region. [provided by RefSeq]
Product Categories/Family for anti-MMP23B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22.6 kDa (199aa)
NCBI Official Full Name
matrix metalloproteinase-23
NCBI Official Synonym Full Names
matrix metallopeptidase 23B
NCBI Official Symbol
MMP23B
NCBI Official Synonym Symbols
MIFR; MMP22; MIFR-1; MMP23A
NCBI Protein Information
matrix metalloproteinase-23
UniProt Protein Name
Matrix metalloproteinase-23
UniProt Gene Name
MMP23A
UniProt Synonym Gene Names
MMP21; MMP-23; MMP-21; MMP-22
UniProt Entry Name
MMP23_HUMAN

NCBI Description

This gene (MMP23B) encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. This gene belongs to the more telomeric copy of the duplicated region. [provided by RefSeq, Jul 2008]

Uniprot Description

MMP23B: Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum. Belongs to the peptidase M10A family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; EC 3.4.24.-; Protease

Chromosomal Location of Human Ortholog: 1p36.3

Cellular Component: proteinaceous extracellular matrix; endoplasmic reticulum membrane; integral to membrane; intracellular

Molecular Function: metallopeptidase activity; zinc ion binding; metalloendopeptidase activity

Biological Process: proteolysis; reproduction

Research Articles on MMP23B

Similar Products

Product Notes

The MMP23B mmp23a (Catalog #AAA6218087) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MMP23B can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MMP23B mmp23a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP23B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.