Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TRIM16 Monoclonal Antibody | anti-TRIM16 antibody

TRIM16 (Tripartite Motif-containing Protein 16, Estrogen-responsive B Box Protein, EBBP) (MaxLight 550)

Gene Names
TRIM16; EBBP
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM16; Monoclonal Antibody; TRIM16 (Tripartite Motif-containing Protein 16; Estrogen-responsive B Box Protein; EBBP) (MaxLight 550); anti-TRIM16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F4
Specificity
Recognizes human TRIM16.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
2992
Applicable Applications for anti-TRIM16 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa165-273 from TRIM16 (NP_006461) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TRIM16 antibody
The TRIM16 gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. TRIM16 contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth and differentiation. The TRIM16 gene is expressed in most tissues, and is more highly expressed in the fetus than in the corresponding adult tissues. TRIM16 may play a role in the regulation of keratinocyte differentiation.
Product Categories/Family for anti-TRIM16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tripartite motif containing 16 (TRIM16), transcript variant 3, mRNA
NCBI Official Synonym Full Names
tripartite motif containing 16
NCBI Official Symbol
TRIM16
NCBI Official Synonym Symbols
EBBP
NCBI Protein Information
tripartite motif-containing protein 16
UniProt Protein Name
Tripartite motif-containing protein 16
UniProt Gene Name
TRIM16
UniProt Synonym Gene Names
EBBP
UniProt Entry Name
TRI16_HUMAN

NCBI Description

The protein encoded by this gene is a tripartite motif (TRIM) family member that contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. While it lacks a RING domain found in other TRIM proteins, the encoded protein can homodimerize or heterodimerize with other TRIM proteins and has E3 ubiquitin ligase activity. This gene is also a tumor suppressor and is involved in secretory autophagy. [provided by RefSeq, Jan 2017]

Uniprot Description

TRIM16: May play a role in the regulation of keratinocyte differentiation. Belongs to the TRIM/RBCC family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: PML body; cytoplasm

Molecular Function: protein binding; NACHT domain binding; DNA binding; zinc ion binding; interleukin-1 binding

Biological Process: response to organophosphorus; response to retinoic acid; positive regulation of transcription, DNA-dependent; positive regulation of retinoic acid receptor signaling pathway; positive regulation of interleukin-1 beta secretion; positive regulation of keratinocyte differentiation

Research Articles on TRIM16

Similar Products

Product Notes

The TRIM16 trim16 (Catalog #AAA6214526) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM16 (Tripartite Motif-containing Protein 16, Estrogen-responsive B Box Protein, EBBP) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM16 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM16 trim16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.