Mouse anti-Human TRIM16 Monoclonal Antibody | anti-TRIM16 antibody

TRIM16 (Tripartite Motif-containing Protein 16, Estrogen-responsive B Box Protein, EBBP) (HRP)

Cat. Num. AAA6155524

• Gene Names: TRIM16; EBBP
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TRIM16; Monoclonal Antibody; TRIM16 (Tripartite Motif-containing Protein 16; Estrogen-responsive B Box Protein; EBBP) (HRP); anti-TRIM16 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5F4
• Specificity: Recognizes human TRIM16.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2992

• Applicable Applications for anti-TRIM16 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa165-273 from TRIM16 (NP_006461) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of TRIM16 expression in transfected 293T cell line by TRIM16 monoclonal antibody Lane 1: TRIM16 transfected lysate (64kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of TRIM16 transfected lysate using TRIM16 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM16 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged TRIM16 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TRIM16 over-expressed 293 cell line, cotransfected with TRIM16 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM16 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-TRIM16 antibody

The TRIM16 gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. TRIM16 contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth and differentiation. The TRIM16 gene is expressed in most tissues, and is more highly expressed in the fetus than in the corresponding adult tissues. TRIM16 may play a role in the regulation of keratinocyte differentiation.

Product Categories/Family for anti-TRIM16 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1130413379
• NCBI GeneID: 10626
• NCBI Accession #: NM_006470.4
• NCBI GenBank Nucleotide #: NM_006470
• UniProt Accession #: O95361
• NCBI Official Full Name: Homo sapiens tripartite motif containing 16 (TRIM16), transcript variant 3, mRNA
• NCBI Official Synonym Full Names: tripartite motif containing 16
• NCBI Official Symbol: TRIM16
• NCBI Official Synonym Symbols: EBBP
• NCBI Protein Information: tripartite motif-containing protein 16
• UniProt Protein Name: Tripartite motif-containing protein 16
• Protein Family: Tripartite motif-containing protein
• UniProt Gene Name: TRIM16
• UniProt Synonym Gene Names: EBBP
• UniProt Entry Name: TRI16_HUMAN

NCBI Description

The protein encoded by this gene is a tripartite motif (TRIM) family member that contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. While it lacks a RING domain found in other TRIM proteins, the encoded protein can homodimerize or heterodimerize with other TRIM proteins and has E3 ubiquitin ligase activity. This gene is also a tumor suppressor and is involved in secretory autophagy. [provided by RefSeq, Jan 2017]

Uniprot Description

TRIM16: May play a role in the regulation of keratinocyte differentiation. Belongs to the TRIM/RBCC family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: PML body; cytoplasm

Molecular Function: protein binding; NACHT domain binding; DNA binding; zinc ion binding; interleukin-1 binding

Biological Process: response to organophosphorus; response to retinoic acid; positive regulation of transcription, DNA-dependent; positive regulation of retinoic acid receptor signaling pathway; positive regulation of interleukin-1 beta secretion; positive regulation of keratinocyte differentiation