Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MECOM Monoclonal Antibody | anti-MECOM antibody

MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, MDS1) (MaxLight 550)

Gene Names
MECOM; EVI1; MDS1; KMT8E; PRDM3; RUSAT2; MDS1-EVI1; AML1-EVI-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MECOM; Monoclonal Antibody; MECOM (MDS1 and EVI1 Complex Locus Protein MDS1; Myelodysplasia Syndrome 1 Protein; Myelodysplasia Syndrome-associated Protein 1; MDS1) (MaxLight 550); anti-MECOM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E7
Specificity
Recognizes human MDS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-MECOM antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa80-169 from human MDS1 (NP_004982) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MECOM antibody
A chromosomal aberration involving MDS1 is found in a form of acute myeloid leukemia (AML). Translocation t(3;21) with AML1.
Product Categories/Family for anti-MECOM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
MDS1 and EVI1 complex locus protein isoform c
NCBI Official Synonym Full Names
MDS1 and EVI1 complex locus
NCBI Official Symbol
MECOM
NCBI Official Synonym Symbols
EVI1; MDS1; KMT8E; PRDM3; RUSAT2; MDS1-EVI1; AML1-EVI-1
NCBI Protein Information
MDS1 and EVI1 complex locus protein; MDS1 and EVI1 complex locus protein EVI1
UniProt Protein Name
MDS1 and EVI1 complex locus protein MDS1
UniProt Gene Name
MECOM
UniProt Synonym Gene Names
MDS1
UniProt Entry Name
MDS1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

MDS1: A chromosomal aberration involving MDS1 is found in a form of acute myeloid leukemia (AML). Translocation t(3;21) with AML1. 6 isoforms of the human protein are produced by alternative promoter.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 3q26.2

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; cytoplasm; histone deacetylase complex; nuclear speck; nucleus

Molecular Function: protein binding; protein homodimerization activity; DNA binding; metal ion binding; transcription factor activity

Biological Process: embryonic forelimb morphogenesis; pericardium development; negative regulation of JNK cascade; transcription, DNA-dependent; in utero embryonic development; regulation of cell cycle; apoptosis; positive regulation of transcription, DNA-dependent; neutrophil homeostasis; embryonic hindlimb morphogenesis; regulation of cell proliferation; post-embryonic development; regulation of transcription, DNA-dependent; response to bacterium; forebrain development; negative regulation of programmed cell death; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; cell differentiation; inflammatory response; negative regulation of transforming growth factor beta receptor signaling pathway

Research Articles on MECOM

Similar Products

Product Notes

The MECOM mecom (Catalog #AAA6212481) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, MDS1) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MECOM can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MECOM mecom for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MECOM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.