Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MAP1S Monoclonal Antibody | anti-MAP1S antibody

MAP1S (BPY2IP1, C19orf5, MAP8, VCY2IP1, Microtubule-associated Protein 1S, BPY2-interacting Protein 1, Microtubule-associated Protein 8, Variable Charge Y Chromosome 2-interacting Protein 1, MAP1S Heavy Chain, MAP1S Light Chain, FLJ10669, MGC133087) (MaxL

Gene Names
MAP1S; MAP8; BPY2IP1; C19orf5; VCY2IP1; VCY2IP-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP1S; Monoclonal Antibody; MAP1S (BPY2IP1; C19orf5; MAP8; VCY2IP1; Microtubule-associated Protein 1S; BPY2-interacting Protein 1; Microtubule-associated Protein 8; Variable Charge Y Chromosome 2-interacting Protein 1; MAP1S Heavy Chain; MAP1S Light Chain; FLJ10669; MGC133087) (MaxL; anti-MAP1S antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H2
Specificity
Recognizes human MAP1S.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-MAP1S antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa929-1027 from human MAP1S (NP_060644) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MAP1S antibody
Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule-organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles (By similarity).
Product Categories/Family for anti-MAP1S antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
microtubule-associated protein 1S isoform 1
NCBI Official Synonym Full Names
microtubule associated protein 1S
NCBI Official Symbol
MAP1S
NCBI Official Synonym Symbols
MAP8; BPY2IP1; C19orf5; VCY2IP1; VCY2IP-1
NCBI Protein Information
microtubule-associated protein 1S
UniProt Protein Name
Microtubule-associated protein 1S
UniProt Gene Name
MAP1S
UniProt Synonym Gene Names
BPY2IP1; C19orf5; MAP8; VCY2IP1; MAP-1S; VCY2-interacting protein 1; VCY2IP-1
UniProt Entry Name
MAP1S_HUMAN

Uniprot Description

BPY2-IP1: Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule-organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles. Belongs to the MAP1 family.

Protein type: Microtubule-binding; Apoptosis

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: microtubule; cell projection; cell soma; perinuclear region of cytoplasm; cytoplasm; dendrite; nucleolus; spindle; synapse; nucleus; cytosol; cell junction

Molecular Function: tubulin binding; actin filament binding; identical protein binding; protein binding; DNA binding; microtubule binding; deoxyribonuclease activity; beta-tubulin binding

Biological Process: nervous system development; brain development; DNA fragmentation during apoptosis; neurite morphogenesis; microtubule bundle formation; mitochondrion transport along microtubule

Research Articles on MAP1S

Similar Products

Product Notes

The MAP1S map1s (Catalog #AAA6212409) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP1S (BPY2IP1, C19orf5, MAP8, VCY2IP1, Microtubule-associated Protein 1S, BPY2-interacting Protein 1, Microtubule-associated Protein 8, Variable Charge Y Chromosome 2-interacting Protein 1, MAP1S Heavy Chain, MAP1S Light Chain, FLJ10669, MGC133087) (MaxL reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP1S can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP1S map1s for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP1S, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.